1. Recombinant Proteins
  2. Receptor Proteins
  3. AGER Protein, Human (HEK293, hFc)

AGER Protein, Human (HEK293, hFc)

Cat. No.: HY-P74604
COA Handling Instructions

AGER proteins are cell surface pattern recognition receptors that expertly sense endogenous stress signals utilizing an extensive library of ligands, including advanced glycation end products, S100 proteins, high mobility Group Box 1 proteins/HMGB1, starch Like protein β/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. AGER Protein, Human (HEK293, hFc) is the recombinant human-derived AGER protein, expressed by HEK293 , with C-hFc labeled tag. The total length of AGER Protein, Human (HEK293, hFc) is 321 a.a., with molecular weight of approximately 76.18 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $35 In-stock
10 μg $60 In-stock
50 μg $170 In-stock
100 μg $290 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

AGER proteins are cell surface pattern recognition receptors that expertly sense endogenous stress signals utilizing an extensive library of ligands, including advanced glycation end products, S100 proteins, high mobility Group Box 1 proteins/HMGB1, starch Like protein β/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. AGER Protein, Human (HEK293, hFc) is the recombinant human-derived AGER protein, expressed by HEK293 , with C-hFc labeled tag. The total length of AGER Protein, Human (HEK293, hFc) is 321 a.a., with molecular weight of approximately 76.18 kDa.

Background

AGER Protein, a cell surface pattern recognition receptor, adeptly senses endogenous stress signals with a wide-ranging ligand repertoire, encompassing advanced glycation end products, S100 proteins, high-mobility group box 1 protein/HMGB1, amyloid beta/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. Accumulation of advanced glycosylation end products, especially prevalent in aging and diabetes, triggers inflammatory responses at various disease sites, including diabetes, vascular complications, neurodegenerative disorders, and cancers. RAGE, upon ligand binding, utilizes TIRAP and MYD88 as adapters to transduce signals, ultimately inducing inflammatory cytokines IL6, IL8, and TNFalpha through NF-kappa-B activation. Noteworthy interactions include S100A12-triggered cellular activation, S100B-induced apoptosis post-myocardial infarction, and the facilitation of amyloid-beta peptide translocation in cortical neurons. AGER also plays a role in endothelial albumin transcytosis with HMGB1 through the RAGE/SRC/Caveolin-1 pathway, leading to endothelial hyperpermeability, and mediates the loading of HMGB1 in extracellular vesicles for hepatocyte pyroptosis via the NLRP3 inflammasome. Additionally, it promotes extracellular hypomethylated DNA uptake for the activation of inflammatory responses. The constitutive homodimeric and oligomeric forms, along with interactions with S100 proteins, APP, TIRAP, and HMGB1, highlight the intricate involvement of AGER Protein in various cellular processes and pathological conditions.

Biological Activity

1.Immobilized Human AGER at 20 μg/mL (100 μL/well) can bind Biotinylated Human HMGB1.The ED50 for this effect is 30.85 ng/mL, corresponding to a specific activity is 3.24×104 Unit/mg.
2.Measured by its binding ability in a functional ELISA. Immobilized human S100A12 at 2 μg/mL (100 μl/well) can bind recombinant human AGER with a linear range of 0.032-20 μg/mL.

  • Immobilized Human AGER at 20 μg/mL (100 μL/well) can bind Biotinylated Human HMGB1.The ED50 for this effect is 30.85ng/mL, corresponding to a specific activity is 3.24×104 Unit/mg.
Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q15109 (Q24-A344)

Gene ID

177  [NCBI]

Molecular Construction
N-term
AGER (Q24-A344)
Accession # Q15109
hFc
C-term
Synonyms
Advanced glycosylation end product-specific receptor; Ager; Rage
AA Sequence

QNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA

Molecular Weight

approximately 76.18 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 (Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.) or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

AGER Protein, Human (HEK293, hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AGER Protein, Human (HEK293, hFc)
Cat. No.:
HY-P74604
Quantity:
MCE Japan Authorized Agent: