1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Angiopoietins
  4. ANG-2
  5. Angiopoietin-2 Protein, Cynomolgus/Rhesus Macaque (222a.a, HEK293, His)

Angiopoietin-2 Protein, Cynomolgus/Rhesus Macaque (222a.a, HEK293, His)

Cat. No.: HY-P76148
Handling Instructions Technical Support

Angiopoietin-2 (Ang2) is a growth factor that belongs to the angiopoietin/Tie (tyrosine kinase with Ig and EGF homology domains) signaling pathway, which is one of the main pathways involved in angiogenesis. Ang2 is a 496 amino acid long protein with a secretory signal peptide, an NH2-terminal coiled-coil domain, and a COOH-terminal fibrinogen-like domain. Ang2 mainly inhibits Ang1-induced Tie2 phosphorylation. Ang2 is critical for endothelial cell physiology and plays a central role in vascular-related diseases by regulating endothelial permeability and angiogenic functions. Angiopoietin-2 Protein, Cynomolgus/Rhesus Macaque (222a.a, HEK293, His) is the recombinant Rhesus Macaque-derived Angiopoietin-2 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Angiopoietin-2 (Ang2) is a growth factor that belongs to the angiopoietin/Tie (tyrosine kinase with Ig and EGF homology domains) signaling pathway, which is one of the main pathways involved in angiogenesis. Ang2 is a 496 amino acid long protein with a secretory signal peptide, an NH2-terminal coiled-coil domain, and a COOH-terminal fibrinogen-like domain. Ang2 mainly inhibits Ang1-induced Tie2 phosphorylation. Ang2 is critical for endothelial cell physiology and plays a central role in vascular-related diseases by regulating endothelial permeability and angiogenic functions. Angiopoietin-2 Protein, Cynomolgus/Rhesus Macaque (222a.a, HEK293, His) is the recombinant Rhesus Macaque-derived Angiopoietin-2 protein, expressed by HEK293 , with N-His labeled tag.

Background

Ang2, a 496 amino acid-long protein, shares ~60% amino acid homology with Ang1 and lacks one of the nine cysteines found in mature Ang1. It has a secretion signal peptide, an NH2-terminal coiled-coil domain, and a COOH-terminal fibrinogen-like domain. Unlike Ang1, Ang2 acts in an autocrine manner and its expression is highly regulated. Similar to Ang1, Ang2 binds to the Tie2 receptor with the same binding affinity, inducing its antagonistic role, but does not bind to Tie1. Ang2 expression is triggered by inflammatory mediators, such as thrombin [4], and conditions, such as hypoxia and cancer[1].
ANGPT2 has been described as a context-dependent antagonist interfering with angiopoietin-1-induced Tie2 phosphorylation to destroy vascular stability and promote angiogenesis, might confer resistance to antiangiogenic therapy. ANGPT2 has been found to be highly expressed in diverse tumor cells and plays an important role in tumor angiogenesis and inflammation[2].

Biological Activity

Immobilized Cynomolgus Angiopoietin-2 His at 2 μg/ml (100 μl/well) can bind Cynomolgus TIE2-hFc, the EC50 of Cynomolgus TIE2-hFc is 15-90 ng/mL.

Species

Rhesus Macaque; Cynomolgus

Source

HEK293

Tag

N-His

Accession

XP_005562586.1/XP_001097949.1 (K274-F495)

Gene ID

101925495  [NCBI]/716811

Molecular Construction
N-term
His
Angiopoietin-2 (K274-F495)
Accession # XP_005562586.1/XP_001097949.1
C-term
Protein Length

Partial

Synonyms
Angiopoietin-2; ANG-2; ANGPT2
AA Sequence

KEEQISFRDCAEVFKSGHTTNGVYTLTLPNSTEEVKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKGTTMMIRPADF

Molecular Weight

Approximately 27.7 kDa.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Angiopoietin-2 Protein, Cynomolgus/Rhesus Macaque (222a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Angiopoietin-2 Protein, Cynomolgus/Rhesus Macaque (222a.a, HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Angiopoietin-2 Protein, Cynomolgus/Rhesus Macaque (222a.a, HEK293, His)
Cat. No.:
HY-P76148
Quantity:
MCE Japan Authorized Agent: