Angiopoietin-2 Protein, Cynomolgus/Rhesus Macaque (HEK293, His)

Angiopoietin-2 (Ang2) is a growth factor that belongs to the angiopoietin/Tie (tyrosine kinase with Ig and EGF homology domains) signaling pathway, which is one of the main pathways involved in angiogenesis. Ang2 is a 496 amino acid long protein with a secretory signal peptide, an NH2-terminal coiled-coil domain, and a COOH-terminal fibrinogen-like domain. Ang2 mainly inhibits Ang1-induced Tie2 phosphorylation. Ang2 is critical for endothelial cell physiology and plays a central role in vascular-related diseases by regulating endothelial permeability and angiogenic functions. Angiopoietin-2 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived Angiopoietin-2 protein, expressed by HEK293 , with C-His labeled tag.

Ang2, a 496 amino acid-long protein, shares ~60% amino acid homology with Ang1 and lacks one of the nine cysteines found in mature Ang1. It has a secretion signal peptide, an NH2-terminal coiled-coil domain, and a COOH-terminal fibrinogen-like domain. Unlike Ang1, Ang2 acts in an autocrine manner and its expression is highly regulated. Similar to Ang1, Ang2 binds to the Tie2 receptor with the same binding affinity, inducing its antagonistic role, but does not bind to Tie1. Ang2 expression is triggered by inflammatory mediators, such as thrombin [4], and conditions, such as hypoxia and cancer^[1].
ANGPT2 has been described as a context-dependent antagonist interfering with angiopoietin-1-induced Tie2 phosphorylation to destroy vascular stability and promote angiogenesis, might confer resistance to antiangiogenic therapy. ANGPT2 has been found to be highly expressed in diverse tumor cells and plays an important role in tumor angiogenesis and inflammation^[2].

Immobilized Recombinant Cynomolgus / Rhesus Angiopoietin-2 / ANG2 Protein (His Tag) at 2 μg/mL (100 μL/well) can bind Recombinant Cynomolgus Tie2 / TEK Protein (Fc Tag) , the EC₅₀ is 80-350 ng/mL.

Rhesus Macaque; Cynomolgus

HEK293

C-His

XP_005562586.1/XP_001097949.1 (Y19-F495)

101925495  [NCBI]/716811

Partial

YNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSKDPTVAKEEQISFRDCAEVFKSGHTTNGVYTLTLPNSTEEVKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKGTTMMIRPADF

Approximately 56.2 kDa.

≥ 90%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 20 mM MOPS, 150 mM NaCl, 0.2% CHAPS, 5% trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Ji-Yan Xie, et al. Angiopoietin-2 induces angiogenesis via exosomes in human hepatocellular carcinoma. Cell Commun Signal. 2020 Mar 17;18(1):46.  [Content Brief]