1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Angiopoietins
  4. Angiopoietins-1/2/3/4
  5. Angiopoietin-2 Protein, Human (222a.a, HEK293, His)

Angiopoietin-2 Protein, Human (222a.a, HEK293, His)

Cat. No.: HY-P7510
Handling Instructions

Angiopoietin-2 Protein, Human (222a.a, HEK293, His) is a circulating antagonistic ligand of the endothelial-specific Tie2 receptor and has been identified as an important gatekeeper of endothelial activation.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $115 In-stock
Estimated Time of Arrival: December 31
50 μg $325 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Angiopoietin-2 Protein, Human (222a.a, HEK293, His)

Angiopoietin-2 Protein, Human (222a.a, HEK293, His) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

HEK 293

Accession

O15123 (K275-F496)

Gene ID

285

Synonyms
rHuAngiopoietin-2, His; ANGPT2; ANG2; Angiopoietin-2
AA Sequence

KEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADFHHHHHH

Molecular Weight

30-35 kDa

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM MOPS, 150 mM NaCl, 10% CHAPS, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Angiopoietins are peptides involved in embryonic vascular development. Of the four angiopoietins that have been identified, angiopoietin 1 and angiopoietin 2 (ANGPT1 and ANGPT2, respectively) are the best described. Angiopoietin 2, produced by endothelial cells, also binds to the Tie2 receptor and acts as an antagonistic factor without activating the receptor.

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Angiopoietin-2 Protein, Human (222a.a, HEK293, His)
Cat. No.:
HY-P7510
Quantity:
MCE Japan Authorized Agent: