Angiopoietin-2 Protein, Human (222a.a, HEK293, His)

Angiopoietin-2 Protein, Human (222a.a, HEK293, His) is a circulating antagonistic ligand of the endothelial-specific Tie2 receptor and has been identified as an important gatekeeper of endothelial activation.

Angiopoietins are peptides involved in embryonic vascular development. Of the four angiopoietins that have been identified, angiopoietin 1 and angiopoietin 2 (ANGPT1 and ANGPT2, respectively) are the best described. Angiopoietin 2, produced by endothelial cells, also binds to the Tie2 receptor and acts as an antagonistic factor without activating the receptor.

Measured by its binding ability in a functional ELISA. Immobilized Human Angiopoietin-2 at 1 μg/mL (100 μL/well) can bind Biotinylated TIE-2. The ED₅₀ for this effect is 11.71 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Human Angiopoietin-2 at 1 μg/mL (100 μL/well) can bind Biotinylated TIE-2. The ED₅₀ for this effect is 11.71 ng/mL.

Human

HEK293

C-6*His

O15123 (K275-F496)

285  [NCBI]

KEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

30-35 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against 20 mM MOPS, 150 mM NaCl, 10% CHAPS, pH 7.5 or 20 mM PB, 150 mM NaCl, pH 7.8.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Angiopoietin 2.