Animal-Free CD30 Ligand/TNFSF8 Protein, Human (His)

CD30 ligand/TNFSF8 protein is a cytokine that specifically binds to TNFRSF8/CD30 and acts as a potent inducer of T cell proliferation. As a homotrimer, this ligand plays a crucial role in regulating T cell activation and growth, contributing to the dynamic coordination of immune responses. Animal-Free CD30 Ligand/TNFSF8 Protein, Human (His) is the recombinant human-derived animal-FreeCD30 Ligand/TNFSF8 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

CD30 Ligand/TNFSF8 protein, a cytokine, specifically binds to TNFRSF8/CD30, acting as a potent inducer of T-cell proliferation. Operating as a homotrimer, this ligand plays a crucial role in regulating the activation and growth of T-cells, contributing to the dynamic orchestration of immune responses. The interaction between CD30 Ligand and its receptor, TNFRSF8/CD30, highlights its significance as a molecular trigger for the robust expansion of T-cell populations.

Measure by its ability to induce IL-8 secretion in human PBMCs. The ED₅₀ for this effect is 10-100 ng/mL.

Human

E. coli

C-6*His

P32971 (Q63-D234)

944  [NCBI]

Extracellular Domain

QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

<0.01 EU per 1 μg of the protein by the LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/ct26-cell.html  [Content Brief]