Animal-Free CD30 Ligand/TNFSF8 Protein, Human (His)

CD30 ligand/TNFSF8 protein is a cytokine that specifically binds to TNFRSF8/CD30 and acts as a potent inducer of T cell proliferation. As a homotrimer, this ligand plays a crucial role in regulating T cell activation and growth, contributing to the dynamic coordination of immune responses. Animal-Free CD30 Ligand/TNFSF8 Protein, Human (His) is the recombinant human-derived animal-FreeCD30 Ligand/TNFSF8 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free CD30 Ligand/TNFSF8 Protein, Human (His) is 172 a.a., with molecular weight of ~20.57 kDa.

CD30 Ligand/TNFSF8 protein, a cytokine, specifically binds to TNFRSF8/CD30, acting as a potent inducer of T-cell proliferation. Operating as a homotrimer, this ligand plays a crucial role in regulating the activation and growth of T-cells, contributing to the dynamic orchestration of immune responses. The interaction between CD30 Ligand and its receptor, TNFRSF8/CD30, highlights its significance as a molecular trigger for the robust expansion of T-cell populations.

Measure by its ability to induce IL-8 secretion in human PBMCs. The ED₅₀ for this effect is <2 ng/mL.

Human

E. coli

C-His

P32971 (Q63-D234)

944  [NCBI]

MQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD

Approximately 20.57 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4.

<0.01 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.