Animal-Free FGF-1 Protein, Human (His)
Based on 1 Customer Validation
FGF-1 protein complexly regulates cell survival, division, angiogenesis, differentiation, and migration. As a potent mitogen, it acts as a ligand for FGFR1 and integrins. Animal-Free FGF-1 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-1 protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FGF-1 protein complexly regulates cell survival, division, angiogenesis, differentiation, and migration. As a potent mitogen, it acts as a ligand for FGFR1 and integrins. Animal-Free FGF-1 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-1 protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.
Background
FGF-1 Protein assumes a pivotal role in intricately regulating cell survival, division, angiogenesis, differentiation, and migration. Functioning as a potent mitogen in vitro, it acts as a ligand for FGFR1 and integrins. Binding to FGFR1, particularly in the presence of heparin, leads to FGFR1 dimerization and activation through sequential autophosphorylation on tyrosine residues. This activation serves as docking sites for interacting proteins, initiating several signaling cascades. Furthermore, FGF-1 Protein binds to integrin ITGAV:ITGB3, forming a ternary complex with integrin and FGFR1, crucial for FGF1 signaling. Inducing the phosphorylation and activation of FGFR1, FRS2, MAPK3/ERK1, MAPK1/ERK2, and AKT1, it demonstrates its involvement in diverse cellular processes. Additionally, FGF-1 Protein's ability to induce angiogenesis further underscores its multifaceted role. Interactions with FGFRs, integrins, and various proteins within complex networks highlight its intricate participation in cellular signaling pathways, emphasizing its significance in cell physiology.
Verified Bioactivity
Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <0.3 ng/mL. The specific activity of recombinant human FGF-1 is >1 x 106 IU/mg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P05230-1 (F16-D155)
-
Molecular Construction
-
N-term
-
FGF-1 (F16-D155)
Accession # P05230-1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
FGF1; Endothelial Cell Growth Factor, Alpha; Prev. FGFA; Fibroblast Growth Factor 1 (Acidic); Heparin-Binding Growth Factor 1; Acidic Fibroblast Growth Factor; AFGF; HBGF-1; ECGF; FGF-1; ECGF-Beta; Beta-Endothelial Cell Growth Factor; FGF-Alpha; Endotheli
-
AA Sequence
FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
-
Predicted Molecular Mass
16.8 kDa
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.
<0.1 EU per 1 μg of the protein by the LAL method.
It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
