Animal-Free I-TAC/CXCL11 Protein, Human (His)

I-TAC/CXCL11 protein selectively attracts interleukin-activated T-cells, inducing calcium release and binding to CXCR3 receptors. It does not attract unstimulated T-cells, neutrophils, or monocytes. This protein may play a role in T-cell recruitment in central nervous system diseases and skin immune responses. It also interacts with TNFAIP6, potentially modulating inflammatory processes. Animal-Free I-TAC/CXCL11 Protein, Human (His) is the recombinant human-derived animal-FreeI-TAC/CXCL11 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

I-TAC/CXCL11 protein demonstrates chemotactic activity specifically for interleukin-activated T-cells while not attracting unstimulated T-cells, neutrophils, or monocytes. It induces calcium release specifically in activated T-cells and binds to CXCR3 receptors. This protein may have a significant role in central nervous system diseases that involve T-cell recruitment, as well as in skin immune responses. Additionally, it interacts with TNFAIP6 through its Link domain, suggesting potential involvement in modulating inflammatory processes.

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR3. The ED₅₀ for this effect is <4 ng/mL.

Human

E. coli

N-6*His

O14625 (F22-F94)

6373  [NCBI]

Full Length of Mature Protein

FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.