Animal-Free IL-17A Protein, Mouse (His)

IL-17A protein is an important effector cytokine that activates the NF-kappa-B and MAPkinase pathways through the IL17RA-IL17RC receptor complex to protect host tissues from microbial threats. As a key Th17 cytokine, IL-17A mediates neutrophil activation, chemotaxis, and contributes to germinal center formation. Animal-Free IL-17A Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-17A protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-17A Protein, Mouse (His) is 133 a.a., with molecular weight of ~15.92 kDa.

IL-17A Protein, an effector cytokine, plays a pivotal role in innate and adaptive immune responses, safeguarding host tissues against microbial threats. Signaling through the IL17RA-IL17RC receptor complex, it activates NF-kappa-B and MAPkinase pathways, orchestrating the transcriptional activation of immune effectors. As a hallmark Th17 cytokine, IL-17A mediates neutrophil activation, chemotaxis, and contributes to germinal center formation. It acts as part of an inflammatory circuit, promoting bacterial clearance, and is crucial for epithelial barrier integrity during homeostasis and infection. IL-17A enhances antiviral defense and, in synergy with IL-17F, induces the production of antimicrobial peptides. Its homodimeric and heterodimeric structures highlight its diverse interactions in immune regulation.

Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED₅₀ for this effect is <1 ng/mL. The specific activity of recombinant mouse IL-17A is > 1 x 10⁶ IU/mg.

Mouse

E. coli

C-His

Q62386 (A26-A158)

16171  [NCBI]

MAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA

Approximately 15.92 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 20 mM sodium citrate, 0.2M NaCl, pH 4.5.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.