Copy Link Print Information

Animal-Free IL-17F Protein, Mouse (His)

Customer Review

Based on 1 Customer Validation

IL-17F Protein, a cytokine belonging to the IL-17 family, is produced using recombinant DNA technology without the use of animal-derived materials. It is involved in inflammatory responses and immune regulation. IL-17F Protein offers a safe and ethical alternative for research and therapeutic applications, addressing concerns related to animal-based production methods. Animal-Free IL-17F Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-17F protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Animal-Free IL-17F Protein, Mouse (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-17F Protein, a cytokine belonging to the IL-17 family, is produced using recombinant DNA technology without the use of animal-derived materials. It is involved in inflammatory responses and immune regulation. IL-17F Protein offers a safe and ethical alternative for research and therapeutic applications, addressing concerns related to animal-based production methods. Animal-Free IL-17F Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-17F protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

Background

IL-17F is a cytokine that plays a role in host defense against extracellular bacteria and fungi. It induces neutrophilic inflammation and activates and recruits neutrophils to infection and inflammatory sites. IL-17F also stimulates the production of antimicrobial proteins by mucosal epithelial cells, limiting the entry of microbes through epithelial barriers. It signals through the IL-17RC homodimeric receptor complex, activating TRAF6 and NF-kappa-B signaling pathways. IL-17F also induces the transcriptional activation of IL33, a cytokine involved in pulmonary allergic response to fungi. It promotes sympathetic innervation of peripheral organs and regulates the composition of intestinal microbiota and immune tolerance. IL-17F forms homodimers and heterodimers with IL-17A and forms complexes with IL17RA and IL17RC receptors.

Verified Bioactivity

Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is <100 ng/mL.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag C-6*His
  • Accession

    Q7TNI7-1 (R29-A161)

  • Gene ID
    257630  [NCBI]
  • Molecular Construction
    • N-term
    • IL-17F (R29-A161)
      Accession # Q7TNI7-1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    IL17F; ML1; Interleukin 17F; Interleukin-17F; IL-17F; Cytokine ML-1; ML-1; CANDF6

  • AA Sequence

    RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA

  • Predicted Molecular Mass

    15.8 kDa

  • Molecular Weight

    Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM sodium citrate, pH 4.5, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Animal-Free IL-17F Protein, Mouse (His) Product Image
    1/16
  • Animal-Free IL-17F Protein, Mouse (His) Product Image