Animal-Free IL-30/IL-27A Protein, Mouse (His)

IL-30/IL-27A Proteinas, an integral Ragulator complex component, crucially senses amino acids and activates mTORC1 for cell growth regulation in response to diverse cues. Lysosomal V-ATPase and the Ragulator complex, acting as a GEF for Rag GTPases, facilitate amino acid activation. Ragulator and Rag GTPases, including LAMTOR2, recruit and activate mTORC1 on lysosomes. LAMTOR2, part of the Ragulator complex, interacts with mTORC1, Rag GTPases, and lysosomal amino acid sensor SLC38A9, contributing to growth and nutrient sensing pathways, including the lysosomal folliculin complex. Animal-Free IL-30/IL-27A Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-30/IL-27A protein, expressed by E. coli, with C-His labeled tag. The total length of Animal-Free IL-30/IL-27A Protein, Mouse (His) is 206 a.a., with molecular weight of ~24.51 kDa.

LAMTOR2, as an integral component of the Ragulator complex, plays a crucial role in amino acid sensing and the activation of mTORC1, a signaling complex pivotal for cell growth regulation in response to various cues such as growth factors, energy levels, and amino acids. Amino acid activation is facilitated by the lysosomal V-ATPase, and the Ragulator complex, acting as both a guanine nucleotide exchange factor (GEF) for small GTPases Rag (RagA/RRAGA, RagB/RRAGB, RagC/RRAGC, and/or RagD/RRAGD) and a mediator for their recruitment to the lysosome membrane. The activated Ragulator and Rag GTPases then serve as a scaffold, recruiting mTORC1 to lysosomes for subsequent activation. LAMTOR2 is part of the Ragulator complex, which also includes LAMTOR1, LAMTOR3, LAMTOR4, and LAMTOR5. The complex interacts with mTORC1, Rag GTPases, and the lysosomal amino acid sensor SLC38A9. Additionally, LAMTOR2 participates in the lysosomal folliculin complex (LFC), contributing to cellular signaling pathways involved in growth and nutrient sensing.

Mouse

E. coli

C-His

Q8K3I6 (F29-S234)

246779  [NCBI]

MFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS

Approximately 24.51 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<0.1 EU per 1 μg of the protein by the LAL method.