Animal-Free IL-30/IL-27A Protein, Mouse (His)

The IL-30/IL-27A protein is a component of the Ragulator complex, which is critical for amino acids and activates mTORC1 to regulate cell growth in response to different signals. The lysosomal V-ATPase and Ragulator complex act as GEFs for Rag GTPase, promoting amino acid activation. Animal-Free IL-30/IL-27A Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-30/IL-27A protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

LAMTOR2, as an integral component of the Ragulator complex, plays a crucial role in amino acid sensing and the activation of mTORC1, a signaling complex pivotal for cell growth regulation in response to various cues such as growth factors, energy levels, and amino acids. Amino acid activation is facilitated by the lysosomal V-ATPase, and the Ragulator complex, acting as both a guanine nucleotide exchange factor (GEF) for small GTPases Rag (RagA/RRAGA, RagB/RRAGB, RagC/RRAGC, and/or RagD/RRAGD) and a mediator for their recruitment to the lysosome membrane. The activated Ragulator and Rag GTPases then serve as a scaffold, recruiting mTORC1 to lysosomes for subsequent activation. LAMTOR2 is part of the Ragulator complex, which also includes LAMTOR1, LAMTOR3, LAMTOR4, and LAMTOR5. The complex interacts with mTORC1, Rag GTPases, and the lysosomal amino acid sensor SLC38A9. Additionally, LAMTOR2 participates in the lysosomal folliculin complex (LFC), contributing to cellular signaling pathways involved in growth and nutrient sensing.

Mouse

E. coli

C-6*His

Q8K3I6 (F29-S234)

246779  [NCBI]

Full Length of Mature Protein

FPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS

Approximately 25 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<0.1 EU per 1 μg of the protein by the LAL method.