1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-36
  5. IL-36β
  6. Animal-Free IL-36 beta/IL-1F8 Protein, Human (His)

Animal-Free IL-36 beta/IL-1F8 Protein, Human (His)

Cat. No.: HY-P74803AF
Handling Instructions Technical Support

IL-36 beta/IL-1F8 protein signals through IL-36R, activates NF-kappa-B and MAPK pathways, and induces pro-inflammatory responses.It is present in the epithelial barrier and shares the IL-1 system coreceptor IL1RAP.Animal-Free IL-36 beta/IL-1F8 Protein, Human (His) is the recombinant human-derived animal-FreeIL-36 beta/IL-1F8 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
2 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

IL-36 beta/IL-1F8 protein signals through IL-36R, activates NF-kappa-B and MAPK pathways, and induces pro-inflammatory responses.It is present in the epithelial barrier and shares the IL-1 system coreceptor IL1RAP.Animal-Free IL-36 beta/IL-1F8 Protein, Human (His) is the recombinant human-derived animal-FreeIL-36 beta/IL-1F8 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Background

IL-36 beta/IL-1F8 protein is a cytokine that binds to and activates the IL1RL2/IL-36R receptor, leading to the activation of NF-kappa-B and MAPK signaling pathways in target cells, resulting in a pro-inflammatory response. It is part of the IL-36 signaling system, which is believed to be present in epithelial barriers and involved in local inflammatory responses, similar to the IL-1 system. IL-36 beta stimulates the production of interleukin-6 and interleukin-8 in various cell types, including synovial fibroblasts, articular chondrocytes, and mature adipocytes. It also induces the expression of antimicrobial peptides and matrix metalloproteases. In the skin, IL-36 beta acts on keratinocytes, dendritic cells, and indirectly on T-cells to promote tissue infiltration, cell maturation, and cell proliferation. In cultured keratinocytes, IL-36 beta induces the expression of chemokines and pro-inflammatory cytokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20, CXCL1, TNF-alpha, IL-8, and IL-6. It interacts with the cargo receptor TMED10, facilitating its translocation from the cytoplasm into the ERGIC and subsequent secretion.

Biological Activity

Measure by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is <0.2 ng/mL.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q9NZH7-2 (R5-E157)

Gene ID
Molecular Construction
N-term
IL-36β (R5-E157)
Accession # Q9NZH7-2
6*His
C-term
Protein Length

Full Length of Isoform 2 Mature Protein

Synonyms
Il36b; Fil1e; Il1f8; Interleukin-36 beta; Interleukin-1 family member 8; IL-1F8
AA Sequence

REAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE

Predicted Molecular Mass
18.2 kDa
분자량

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US;may vary elsewhere.

각종 서류

Animal-Free IL-36 beta/IL-1F8 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Animal-Free IL-36 beta/IL-1F8 Protein, Human (His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Animal-Free IL-36 beta/IL-1F8 Protein, Human (His)
Cat. No.:
HY-P74803AF
수량:
MCE Japan Authorized Agent: