1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-37
  5. Animal-Free IL-37 Protein, Human (His)

IL-37 protein is an important immunoregulatory cytokine that suppresses innate inflammation and immune responses and reduces excessive inflammation.It signals intracellularly through nuclear translocation of SMAD3 and extracellularly through binding to its receptors, consisting of IL18R1 and IL18RAP.Animal-Free IL-37 Protein, Human (His) is the recombinant human-derived animal-FreeIL-37 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
2 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

IL-37 protein is an important immunoregulatory cytokine that suppresses innate inflammation and immune responses and reduces excessive inflammation.It signals intracellularly through nuclear translocation of SMAD3 and extracellularly through binding to its receptors, consisting of IL18R1 and IL18RAP.Animal-Free IL-37 Protein, Human (His) is the recombinant human-derived animal-FreeIL-37 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Background

IL-37 Protein, an immune regulatory cytokine, plays a pivotal role as a suppressor of innate inflammatory and immune responses, mitigating excessive inflammation. Signaling occurs through two distinct mechanisms: intracellularly via nuclear translocation with SMAD3 and extracellularly after secretion and binding to its receptor, composed of IL18R1 and IL18RAP. IL-37 suppresses or reduces the production of pro-inflammatory cytokines, including IL1A, IL6, CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A, and IL1RN, while sparing anti-inflammatory cytokines. It also inhibits dendritic cell activation. IL-37 interacts with SMAD3 and binds IL18R1, albeit with lower affinity than IL18, without acting as a receptor antagonist for IL18. Additionally, it forms a complex with the cargo receptor TMED10, facilitating translocation from the cytoplasm into the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) and subsequent secretion.

Biological Activity

Measure by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is <0.9 µg/mL

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q9NZH6-1 (K53-D218)

Gene ID
Molecular Construction
N-term
IL-37 (K53-D218)
Accession # Q9NZH6-1
6*His
C-term
Protein Length

Partial

Synonyms
Interleukin-37; FIL1 Zeta; IL-1X; Interleukin-1 Family Member 7; IL-1F7; Interleukin-1 Homolog 4; IL-1H; IL-1H4; Interleukin-1 Zeta; IL-1 Zeta; Interleukin-1-Related Protein; IL-1RP1; Interleukin-23; IL-37; IL37; FIL1Z; IL1F7; IL1H4; IL1RP1
AA Sequence

KNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD

Predicted Molecular Mass
19.5 kDa
분자량

Approximately 22 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

Animal-Free IL-37 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Animal-Free IL-37 Protein, Human (His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Animal-Free IL-37 Protein, Human (His)
Cat. No.:
HY-P700128AF
수량:
MCE Japan Authorized Agent: