Animal-Free Neurturin Protein, Mouse (His)

Neurturin, forming homodimers through disulfide links, promotes the survival of sympathetic neurons in culture.It potentially plays a role in regulating the development and maintenance of the central nervous system (CNS) and influencing the size of non-neuronal cell populations, such as haemopoietic cells.Animal-Free Neurturin Protein, Mouse (His) is the recombinant mouse-derived animal-FreeNeurturin protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Neurturin, a crucial factor in neuronal support, plays a pivotal role in fostering the survival of sympathetic neurons in cultured environments. Its potential extends beyond neuronal realms, as it is implicated in the regulation of central nervous system (CNS) development and maintenance. Additionally, Neurturin exhibits the capacity to influence the size of non-neuronal cell populations, including but not limited to haemopoietic cells. Structurally, Neurturin manifests as a homodimer, connected through disulfide linkages, accentuating its role as a multifaceted player in cellular homeostasis and development.

Measure by its ability to induce proliferation in SH-SY5Y cells. The ED₅₀ for this effect is <50 ng/mL.

Mouse

E. coli

N-6*His

P97463.1 (P96-V195)

18188  [NCBI]

Full Length of Mature Protein

PGARPCGLRELEVRVSELGLGYTSDETVLFRYCAGACEAAIRIYDLGLRRLRQRRRVRRERARAHPCCRPTAYEDEVSFLDVHSRYHTLQELSARECACV

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose or PBS, pH 7.4.

<0.1 EU per 1 μg of the protein by the LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.