1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens Animal-free Recombinant Proteins
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules Macrophage CD Proteins
  4. TNF Superfamily Ligands OX40 Ligand/CD252
  5. OX40 Ligand
  6. Animal-Free OX40 Ligand/TNFSF4 Protein, Mouse (His)

Animal-Free OX40 Ligand/TNFSF4 Protein, Mouse (His)

Cat. No.: HY-P700225AF
COA Handling Instructions

The OX40 ligand/TNFSF4 protein is a cytokine that selectively binds to TNFRSF4 and serves as a key costimulator for T cell proliferation and cytokine production. As a homotrimer, this ligand plays a key role in modulating immune responses, particularly in enhancing T cell activation and function. Animal-Free OX40 Ligand/TNFSF4 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeOX40 Ligand/TNFSF4 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free OX40 Ligand/TNFSF4 Protein, Mouse (His) is 148 a.a., with molecular weight of ~17.68 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $68 In-stock
10 μg $190 In-stock
50 μg $530 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The OX40 ligand/TNFSF4 protein is a cytokine that selectively binds to TNFRSF4 and serves as a key costimulator for T cell proliferation and cytokine production. As a homotrimer, this ligand plays a key role in modulating immune responses, particularly in enhancing T cell activation and function. Animal-Free OX40 Ligand/TNFSF4 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeOX40 Ligand/TNFSF4 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free OX40 Ligand/TNFSF4 Protein, Mouse (His) is 148 a.a., with molecular weight of ~17.68 kDa.

Background

OX40 Ligand/TNFSF4 protein, a cytokine, selectively binds to TNFRSF4, functioning as a critical co-stimulator for T-cell proliferation and cytokine production. Operating as a homotrimer, this ligand plays a key role in regulating immune responses, particularly in enhancing the activation and function of T-cells. Its engagement with TNFRSF4 highlights its significance as a molecular trigger for robust and targeted T-cell responses, contributing to the intricate orchestration of the immune system.

Biological Activity

Measure by its ability to induce IL-2 secretion in mouse T cells in the presence of the anti-CD3 antibody. The ED50 for this effect is <25 ng/mL.

Species

Mouse

Source

E. coli

Tag

N-His

Accession

P43488 (S51-L198)

Gene ID

22164  [NCBI]

Molecular Construction
N-term
His
OX40L (S51-L198)
Accession # P43488
C-term
Synonyms
Tumor necrosis factor ligand superfamily member 4; OX40 ligand; OX40L; CD252; Tnfsf4
AA Sequence

QLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL

Molecular Weight

Approximately 17.68 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free OX40 Ligand/TNFSF4 Protein, Mouse (His)
Cat. No.:
HY-P700225AF
Quantity:
MCE Japan Authorized Agent: