1. Recombinant Proteins
  2. Receptor Proteins Enzymes & Regulators
  3. Receptor Tyrosine Kinases Protein Tyrosine Kinases
  4. TAM Receptor
  5. Axl Proteins
  6. AXL Protein, Cynomolgus (HEK293, His)

AXL Protein, a receptor tyrosine kinase, mediates signals by binding GAS6, regulating cell survival, proliferation, migration, and differentiation. Upon ligand binding, AXL undergoes dimerization and autophosphorylation, activating downstream molecules like PI3-kinase subunits, GRB2, PLCG1, and more. This triggers AKT kinase activation, influencing processes such as endothelial cell survival, cytokine signaling in NK cell development, hepatic regeneration, gonadotropin-releasing hormone neuron function, platelet activation, thrombotic responses, and immune modulation. AXL also serves as a receptor for lassa virus and lymphocytic choriomeningitis virus during microbial infection. AXL Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived AXL protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

AXL Protein, a receptor tyrosine kinase, mediates signals by binding GAS6, regulating cell survival, proliferation, migration, and differentiation. Upon ligand binding, AXL undergoes dimerization and autophosphorylation, activating downstream molecules like PI3-kinase subunits, GRB2, PLCG1, and more. This triggers AKT kinase activation, influencing processes such as endothelial cell survival, cytokine signaling in NK cell development, hepatic regeneration, gonadotropin-releasing hormone neuron function, platelet activation, thrombotic responses, and immune modulation. AXL also serves as a receptor for lassa virus and lymphocytic choriomeningitis virus during microbial infection. AXL Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived AXL protein, expressed by HEK293 , with C-His labeled tag.

Background

AXL, a receptor tyrosine kinase, serves as a key mediator in transducing signals from the extracellular matrix into the cytoplasm by binding the growth factor GAS6, thereby regulating diverse physiological processes such as cell survival, proliferation, migration, and differentiation. Ligand binding at the cell surface induces AXL dimerization and autophosphorylation. Upon activation, AXL interacts with and induces the tyrosine phosphorylation of various downstream signaling molecules, including PI3-kinase subunits (PIK3R1, PIK3R2, and PIK3R3), GRB2, PLCG1, LCK, PTPN11, CBL, NCK2, SOCS1, and TNS2. This triggers the recruitment of GRB2 and regulatory subunits of phosphatidylinositol 3 kinase, leading to the downstream activation of the AKT kinase. The GAS6/AXL signaling axis plays a pivotal role in various processes such as endothelial cell survival, optimal cytokine signaling during human natural killer cell development, hepatic regeneration, gonadotropin-releasing hormone neuron survival and migration, platelet activation, and the regulation of thrombotic responses. Additionally, AXL is involved in inhibiting Toll-like receptors (TLRs)-mediated innate immune responses, and in the context of microbial infection, it acts as a receptor for lassa virus and lymphocytic choriomeningitis virus, possibly through GAS6 binding to phosphatidyl-serine at the surface of the virion envelope[1][2][3][4].

Biological Activity

1.This product does not contain protein kinase domain.
2.Immobilized Cynomolgus AXL, His Tag at 0.5 μg/mL (100 μl/Well) on the plate. Dose response curve for Anti-AXL Antibody, hFc Tag with the EC50 of ≤9.4 ng/mL determined by ELISA.

Species

Cynomolgus

Source

HEK293

Tag

C-8*His

Accession

A0A1D5Q330 (E33-P449)

Gene ID

/

Molecular Construction
N-term
AXL (E33-P449)
Accession # A0A1D5Q330
8*His
C-term
Protein Length

Extracellular Domain

Synonyms
Axl; UFO; AXL oncogene; AXL; ARK; JTK11; Tyro7; AI323647; EC 2.7.10; EC 2.7.10.1
AA Sequence

EESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVVSQLRIASLQLSDAGQYQCLVFLGHQNFVSQPGYVGLEGLPYFLEEPEDRTVAANTHFNLSCQAQGPPEPVDLLWLQDAVPLATAPGHGPQRNLHVPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQQPRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTLQAMLSDNEVGIQAGEPDPPEEPLTLQASVPPHQLRLGSLHPHTPYYIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQGDGSVSNLTVCVAAYTAAGDGPWSLPVPLEAWRPGQAQPVHQLVKETSAPAFSWP

Molecular Weight

68-70 kDa

Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

AXL Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AXL Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P77567
Quantity:
MCE Japan Authorized Agent: