AXL Protein, Cynomolgus (HEK293, His)

Customer Review

Based on 1 Customer Validation

AXL Protein, a receptor tyrosine kinase, mediates signals by binding GAS6, regulating cell survival, proliferation, migration, and differentiation. Upon ligand binding, AXL undergoes dimerization and autophosphorylation, activating downstream molecules like PI3-kinase subunits, GRB2, PLCG1, and more. This triggers AKT kinase activation, influencing processes such as endothelial cell survival, cytokine signaling in NK cell development, hepatic regeneration, gonadotropin-releasing hormone neuron function, platelet activation, thrombotic responses, and immune modulation. AXL also serves as a receptor for lassa virus and lymphocytic choriomeningitis virus during microbial infection. AXL Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived AXL protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

AXL Protein, a receptor tyrosine kinase, mediates signals by binding GAS6, regulating cell survival, proliferation, migration, and differentiation. Upon ligand binding, AXL undergoes dimerization and autophosphorylation, activating downstream molecules like PI3-kinase subunits, GRB2, PLCG1, and more. This triggers AKT kinase activation, influencing processes such as endothelial cell survival, cytokine signaling in NK cell development, hepatic regeneration, gonadotropin-releasing hormone neuron function, platelet activation, thrombotic responses, and immune modulation. AXL also serves as a receptor for lassa virus and lymphocytic choriomeningitis virus during microbial infection. AXL Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived AXL protein, expressed by HEK293 , with C-His labeled tag.

Background

AXL, a receptor tyrosine kinase, serves as a key mediator in transducing signals from the extracellular matrix into the cytoplasm by binding the growth factor GAS6, thereby regulating diverse physiological processes such as cell survival, proliferation, migration, and differentiation. Ligand binding at the cell surface induces AXL dimerization and autophosphorylation. Upon activation, AXL interacts with and induces the tyrosine phosphorylation of various downstream signaling molecules, including PI3-kinase subunits (PIK3R1, PIK3R2, and PIK3R3), GRB2, PLCG1, LCK, PTPN11, CBL, NCK2, SOCS1, and TNS2. This triggers the recruitment of GRB2 and regulatory subunits of phosphatidylinositol 3 kinase, leading to the downstream activation of the AKT kinase. The GAS6/AXL signaling axis plays a pivotal role in various processes such as endothelial cell survival, optimal cytokine signaling during human natural killer cell development, hepatic regeneration, gonadotropin-releasing hormone neuron survival and migration, platelet activation, and the regulation of thrombotic responses. Additionally, AXL is involved in inhibiting Toll-like receptors (TLRs)-mediated innate immune responses, and in the context of microbial infection, it acts as a receptor for lassa virus and lymphocytic choriomeningitis virus, possibly through GAS6 binding to phosphatidyl-serine at the surface of the virion envelope[1][2][3][4].

Verified Bioactivity

1.This product does not contain protein kinase domain.
2.Immobilized Cynomolgus AXL, His Tag at 0.5 μg/mL (100 μl/Well) on the plate. Dose response curve for Anti-AXL Antibody, hFc Tag with the EC50 of ≤9.4 ng/mL determined by ELISA.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • AXL (E33-P449)
      Accession # A0A1D5Q330
    • 8*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    AXL; Tyrosine-Protein Kinase Receptor UFO; AXL Receptor Tyrosine Kinase; AXL Oncogene; UFO; Receptor Protein-Tyrosine Kinase; JTK11; AXL Transforming Sequence/Gene; Tyro7; AXL3; ARK

  • AA Sequence

    EESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVVSQLRIASLQLSDAGQYQCLVFLGHQNFVSQPGYVGLEGLPYFLEEPEDRTVAANTHFNLSCQAQGPPEPVDLLWLQDAVPLATAPGHGPQRNLHVPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQQPRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTLQAMLSDNEVGIQAGEPDPPEEPLTLQASVPPHQLRLGSLHPHTPYYIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQGDGSVSNLTVCVAAYTAAGDGPWSLPVPLEAWRPGQAQPVHQLVKETSAPAFSWP

  • Predicted Molecular Mass

    46.3 kDa

  • Molecular Weight

    Approximately 68-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00