AXL Protein, Cynomolgus (HEK293, His)
Based on 1 Customer Validation
AXL Protein, a receptor tyrosine kinase, mediates signals by binding GAS6, regulating cell survival, proliferation, migration, and differentiation. Upon ligand binding, AXL undergoes dimerization and autophosphorylation, activating downstream molecules like PI3-kinase subunits, GRB2, PLCG1, and more. This triggers AKT kinase activation, influencing processes such as endothelial cell survival, cytokine signaling in NK cell development, hepatic regeneration, gonadotropin-releasing hormone neuron function, platelet activation, thrombotic responses, and immune modulation. AXL also serves as a receptor for lassa virus and lymphocytic choriomeningitis virus during microbial infection. AXL Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived AXL protein, expressed by HEK293 , with C-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
AXL Protein, a receptor tyrosine kinase, mediates signals by binding GAS6, regulating cell survival, proliferation, migration, and differentiation. Upon ligand binding, AXL undergoes dimerization and autophosphorylation, activating downstream molecules like PI3-kinase subunits, GRB2, PLCG1, and more. This triggers AKT kinase activation, influencing processes such as endothelial cell survival, cytokine signaling in NK cell development, hepatic regeneration, gonadotropin-releasing hormone neuron function, platelet activation, thrombotic responses, and immune modulation. AXL also serves as a receptor for lassa virus and lymphocytic choriomeningitis virus during microbial infection. AXL Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived AXL protein, expressed by HEK293 , with C-His labeled tag.
Background
AXL, a receptor tyrosine kinase, serves as a key mediator in transducing signals from the extracellular matrix into the cytoplasm by binding the growth factor GAS6, thereby regulating diverse physiological processes such as cell survival, proliferation, migration, and differentiation. Ligand binding at the cell surface induces AXL dimerization and autophosphorylation. Upon activation, AXL interacts with and induces the tyrosine phosphorylation of various downstream signaling molecules, including PI3-kinase subunits (PIK3R1, PIK3R2, and PIK3R3), GRB2, PLCG1, LCK, PTPN11, CBL, NCK2, SOCS1, and TNS2. This triggers the recruitment of GRB2 and regulatory subunits of phosphatidylinositol 3 kinase, leading to the downstream activation of the AKT kinase. The GAS6/AXL signaling axis plays a pivotal role in various processes such as endothelial cell survival, optimal cytokine signaling during human natural killer cell development, hepatic regeneration, gonadotropin-releasing hormone neuron survival and migration, platelet activation, and the regulation of thrombotic responses. Additionally, AXL is involved in inhibiting Toll-like receptors (TLRs)-mediated innate immune responses, and in the context of microbial infection, it acts as a receptor for lassa virus and lymphocytic choriomeningitis virus, possibly through GAS6 binding to phosphatidyl-serine at the surface of the virion envelope[1][2][3][4].
Verified Bioactivity
1.This product does not contain protein kinase domain.
2.Immobilized Cynomolgus AXL, His Tag at 0.5 μg/mL (100 μl/Well) on the plate. Dose response curve for Anti-AXL Antibody, hFc Tag with the EC50 of ≤9.4 ng/mL determined by ELISA.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-8*His
-
Accession
A0A1D5Q330 (E33-P449)
-
Gene ID/
-
Molecular Construction
-
N-term
-
AXL (E33-P449)
Accession # A0A1D5Q330 -
8*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
AXL; Tyrosine-Protein Kinase Receptor UFO; AXL Receptor Tyrosine Kinase; AXL Oncogene; UFO; Receptor Protein-Tyrosine Kinase; JTK11; AXL Transforming Sequence/Gene; Tyro7; AXL3; ARK
-
AA Sequence
EESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVVSQLRIASLQLSDAGQYQCLVFLGHQNFVSQPGYVGLEGLPYFLEEPEDRTVAANTHFNLSCQAQGPPEPVDLLWLQDAVPLATAPGHGPQRNLHVPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQQPRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTLQAMLSDNEVGIQAGEPDPPEEPLTLQASVPPHQLRLGSLHPHTPYYIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQGDGSVSNLTVCVAAYTAAGDGPWSLPVPLEAWRPGQAQPVHQLVKETSAPAFSWP
-
Predicted Molecular Mass
46.3 kDa
-
Molecular Weight
Approximately 68-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (239 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)