1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens Receptor Proteins
  3. Inhibitory Checkpoint Molecules Stimulatory Immune Checkpoint Molecules NK Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Platelet CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins Cell Adhesion Molecules (CAMs)
  4. Immunoglobulin-like Cell Adhesion Molecules
  5. Nectin-2/CD112
  6. Nectin-2/CD112 Protein, Human (HEK293, His)

Nectin-2/CD112 Protein, Human (HEK293, His)

Cat. No.: HY-P7780
COA Handling Instructions

CD112 Protein, Human (HEK293, His) is a recombinant human CD112 expressed in HEK 293 cells with a His tag at the N-terminus. Recombinant Human CD112 can be used as cell surface ligands for the human DNAM-1 (CD226) activating molecule.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $95 In-stock
50 μg $285 In-stock
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CD112 Protein, Human (HEK293, His) is a recombinant human CD112 expressed in HEK 293 cells with a His tag at the N-terminus. Recombinant Human CD112 can be used as cell surface ligands for the human DNAM-1 (CD226) activating molecule[1][2].

Background

Nectin-2 (CD112) is a 60 (Nectin-2 α) or 65 kDa (Nectin-2 δ) type I TM glycoprotein that expressed in a variety of cells. Nectin is a Ca2+-independent immunoglobulin-like intercellular adhesion molecule. Nectin comprises a family of at least four members nectin-1, nectin-2, nectin-3 and nectin-4. All the members have two or three splice variants (except nectin-4), and have an extracellular region containing three Ig-like domains, a single transmembrane region and a cytoplasmic region (except nectin-1γ). Nectin-1, nectin-2 and nectin-3 are ubiquitously expressed in a variety of cells. Nectin-2 and nectin-3 are also expressed in cells that lack cadherins. Human nectin-4 is expressed mainly in the placenta[1][2].

Biological Activity

Immobilized Human DNAM-1-Fc at 2μg/ml (100 μl/well) can bind recombinant Human CD112, His (HEK293-expressed) (rHuCD112, His). The ED50 of recombinant Human CD112, His (HEK293-expressed) (rHuCD112, His) is 0.3-1.5 μg/mL.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q92692-2 (Q32-L360)

Gene ID
Synonyms
rHuCD112, His; Poliovirus Receptor-Related Protein 2; Herpes Virus Entry Mediator B; Herpesvirus Entry Mediator B; CD112; PVRL2; HVEB; PRR2
AA Sequence

QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPRASPRDVGPLHHHHHH

Molecular Weight

Approximately 50 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Nectin-2/CD112 Protein, Human (HEK293, His)
Cat. No.:
HY-P7780
Quantity:
MCE Japan Authorized Agent: