Nectin-2/CD112 Protein, Human (HEK293, His)
Based on 1 Customer Validation
CD112 Protein, Human (HEK293, His) is a recombinant human CD112 expressed in HEK 293 cells with a His tag at the N-terminus. Recombinant Human CD112 can be used as cell surface ligands for the human DNAM-1 (CD226) activating molecule.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
CD112 Protein, Human (HEK293, His) is a recombinant human CD112 expressed in HEK 293 cells with a His tag at the N-terminus. Recombinant Human CD112 can be used as cell surface ligands for the human DNAM-1 (CD226) activating molecule[1][2].
Nectin-2 (CD112) is a 60 (Nectin-2 α) or 65 kDa (Nectin-2 δ) type I TM glycoprotein that expressed in a variety of cells. Nectin is a Ca2+-independent immunoglobulin-like intercellular adhesion molecule. Nectin comprises a family of at least four members nectin-1, nectin-2, nectin-3 and nectin-4. All the members have two or three splice variants (except nectin-4), and have an extracellular region containing three Ig-like domains, a single transmembrane region and a cytoplasmic region (except nectin-1γ). Nectin-1, nectin-2 and nectin-3 are ubiquitously expressed in a variety of cells. Nectin-2 and nectin-3 are also expressed in cells that lack cadherins. Human nectin-4 is expressed mainly in the placenta[1][2].
Immobilized Human DNAM-1-Fc at 2μg/ml (100 μl/well) can bind recombinant Human CD112, His (HEK293-expressed) (rHuCD112, His). The ED50 of recombinant Human CD112, His (HEK293-expressed) (rHuCD112, His) is 0.3-1.5 μg/mL.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q92692-2 (Q32-L360)
-
Molecular Construction
-
N-term
-
CD112 (Q32-L360)
Accession # Q92692-2 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
NECTIN2; Poliovirus Receptor-Related 2 (Herpesvirus Entry Mediator B); Prev. PVRL2; Herpes Virus Entry Mediator B; Prev. HVEB; Herpesvirus Entry Mediator B; Nectin-2; Herpesvirus Entry Protein B; PRR2; Poliovirus Receptor-Like 2; PVRR2; CD112 Antigen; CD1
-
AA Sequence
QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPRASPRDVGPL
-
Predicted Molecular Mass
36.6 kDa
-
Molecular Weight
Approximately 45-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Takai Y, et, al. Nectin and afadin: novel organizers of intercellular junctions. J Cell Sci. 2003 Jan 1;116(Pt 1):17-27. [Content Brief]
[2]. Bottino C, et, al. Identification of PVR (CD155) and Nectin-2 (CD112) as cell surface ligands for the human DNAM-1 (CD226) activating molecule. J Exp Med. 2003 Aug 18;198(4):557-67. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
