CD299 Protein, Human (HEK293, His-Flag)
Based on 1 Customer Validation
CD299 protein showcases an unconventional genetic architecture with a non-canonical intron-exon splice junction, highlighting unique structural features. CD299 Protein, Human (HEK293, His-Flag) is the recombinant human-derived CD299 protein, expressed by HEK293 , with N-Flag, N-8*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD299 protein showcases an unconventional genetic architecture with a non-canonical intron-exon splice junction, highlighting unique structural features. CD299 Protein, Human (HEK293, His-Flag) is the recombinant human-derived CD299 protein, expressed by HEK293 , with N-Flag, N-8*His labeled tag.
Background
CD299 protein exhibits a non-canonical intron-exon splice junction, emphasizing an unconventional configuration in its genetic architecture.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-Flag;N-8*His
-
Accession
Q9H2X3-8 (S73-E376)
-
Molecular Construction
-
N-term
-
8*His-Flag
-
CD299 (S73-E376)
Accession # Q9H2X3-8 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CLEC4M; Dendritic Cell-Specific ICAM-3-Grabbing Non-Integrin 2; Prev. CD209L; DC-SIGN-Related Protein; Prev. CD299; L-SIGN; DC-SIGNR; Liver/Lymph Node-Specific ICAM-3 Grabbing Non-Integrin; DC-SIGN2; Liver/Lymph Node-Specific ICAM-3-Grabbing Non-Integrin;
-
AA Sequence
SKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE
-
Predicted Molecular Mass
37 kDa
-
Molecular Weight
Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
