CDKN2A Protein, Human

CDKN2A Protein, a potent negative regulator of cell proliferation, forms strong interactions with CDK4 and CDK6, hindering their association with cyclins D and retinoblastoma protein phosphorylation. Acting in a heterodimeric manner, predominantly with CDK6, CDKN2A inhibits cyclin D-CDK4 kinase activity and interacts with ISCO2, contributing to its cell cycle regulatory role. CDKN2A Protein, Human is the recombinant human-derived CDKN2A protein, expressed by E. coli , with tag free. The total length of CDKN2A Protein, Human is 155 a.a., with molecular weight of ~19.12 kDa.

CDKN2A Protein serves as a potent negative regulator of normal cell proliferation by forming robust interactions with CDK4 and CDK6, thereby impeding their association with cyclins D and hampering the phosphorylation of the retinoblastoma protein. It functions in a heterodimeric fashion with either CDK4 or CDK6, with the majority of p16 complexes predominantly featuring CDK6. The interaction with CDK4, occurring with both 'T-172'-phosphorylated and non-phosphorylated forms, effectively inhibits the kinase activity of cyclin D-CDK4. Additionally, CDKN2A Protein engages with ISCO2, contributing to its regulatory role in cell cycle progression.

Data is not available.

Human

E. coli

Tag Free

P42771 (E2-D156)

1029  [NCBI]

EPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD

Approximately 19.12 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg; determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.