CDKN2A Protein, Human
Based on 1 publication(s) in Google Scholar
CDKN2A Protein, a potent negative regulator of cell proliferation, forms strong interactions with CDK4 and CDK6, hindering their association with cyclins D and retinoblastoma protein phosphorylation. Acting in a heterodimeric manner, predominantly with CDK6, CDKN2A inhibits cyclin D-CDK4 kinase activity and interacts with ISCO2, contributing to its cell cycle regulatory role. CDKN2A Protein, Human is the recombinant human-derived CDKN2A protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
CDKN2A Protein, a potent negative regulator of cell proliferation, forms strong interactions with CDK4 and CDK6, hindering their association with cyclins D and retinoblastoma protein phosphorylation. Acting in a heterodimeric manner, predominantly with CDK6, CDKN2A inhibits cyclin D-CDK4 kinase activity and interacts with ISCO2, contributing to its cell cycle regulatory role. CDKN2A Protein, Human is the recombinant human-derived CDKN2A protein, expressed by E. coli , with tag free.
CDKN2A Protein serves as a potent negative regulator of normal cell proliferation by forming robust interactions with CDK4 and CDK6, thereby impeding their association with cyclins D and hampering the phosphorylation of the retinoblastoma protein. It functions in a heterodimeric fashion with either CDK4 or CDK6, with the majority of p16 complexes predominantly featuring CDK6. The interaction with CDK4, occurring with both 'T-172'-phosphorylated and non-phosphorylated forms, effectively inhibits the kinase activity of cyclin D-CDK4. Additionally, CDKN2A Protein engages with ISCO2, contributing to its regulatory role in cell cycle progression.
Publications (1)
-
Journal Impact Factor
-
Most Recent
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P42771 (E2-D156)
-
Molecular Construction
-
N-term
-
CDKN2A (E2-D156)
Accession # P42771 -
C-term
-
-
Protein Length
Partial
-
Synonyms
CDKN2A; Cyclin-Dependent Kinase Inhibitor 2A (Melanoma, P16, Inhibits CDK4); Prev. CDKN2; Multiple Tumor Suppressor 1; Prev. MLM; CDKN2A/ARF Intron 2 LncRNA; P14ARF; Alternative Reading Frame; CDK4I; Inhibitor Of Cdk4 A; MTS1; MTS-1; P16; Truncated Tumor
-
AA Sequence
EPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
-
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg; determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
