CEACAM1 Protein, Rat (HEK293, His)

CEACAM1 protein is involved in the regulation of hepatic lipogenesis and inhibition of cell proliferation. It interacts with INSR to reduce fatty acid synthesis and with SHC1 to inhibit cell proliferation. CEACAM1 Protein, Rat (HEK293, His) is the recombinant rat-derived CEACAM1 protein, expressed by HEK293 , with C-10*His labeled tag.

The CD31/PECAM-1 protein, a pivotal cell adhesion molecule, is indispensable for leukocyte transendothelial migration (TEM) in the majority of inflammatory scenarios. The critical role of Tyr-690 in TEM is highlighted by its involvement in the efficient trafficking of PECAM1 to and from the lateral border recycling compartment (LBRC), essential for targeting the LBRC membrane around migrating leukocytes. This protein engages in trans-homophilic interactions that likely contribute to endothelial cell-cell adhesion through cell junctions, while its heterophilic interaction with CD177 plays a crucial role in the transendothelial migration of neutrophils. Homophilic ligation of PECAM1 serves a dual purpose, preventing macrophage-mediated phagocytosis of neighboring viable leukocytes by transmitting a detachment signal, while simultaneously promoting macrophage-mediated phagocytosis of apoptotic leukocytes by tethering them to the phagocytic cells. Beyond its role in cell adhesion, CD31/PECAM-1 modulates bradykinin receptor BDKRB2 activation and regulates ERK1/2 activation in endothelial cells induced by bradykinin and hyperosmotic shock. Despite its versatility, CD31/PECAM-1 has a notable impact on atherosclerosis susceptibility while lacking a protective effect against apoptosis. This underscores the multifaceted functions of CD31/PECAM-1 in orchestrating diverse aspects of immune and endothelial cell responses.

Rat

HEK293

C-10*His

P16573-1 (Q35-S422)

81613  [NCBI]

Extracellular Domain

QVTVDAVPPNVVEEKSVLLLAHNLPQEFQVFYWYKGTTLNPDSEIARYIRSDNMSKTGPAYSGRETIYSNGSLFFQNVNKTDERAYTLSVFDQQFNPIQTSVQFRVYPALQKPNVTGNNSNPMEGEPFVSLMCEPYTNNTSYLWSRNGESLSEGDRVTFSEGNRTLTLLNVRRTDKGYYECEARNPATFNRSDPFNLDVIYGPDAPVISPPDIYLHQGSNLNLSCHADSNPPAQYFWLINEKLQTSSQELFISNITTNNSGTYACFVNNTVTGLSRTTVKNITVFEPVTQPSIQITNTTVKELGSVTLTCFSKDTGVSVRWLFNSQSLQLTDRMTLSQDNSTLRIDPIKREDAGDYQCEISNPVSFRISHPIKLDVIPDPTQGNSGLS

66-76 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.