1. Recombinant Proteins
  2. Receptor Proteins
  3. Pattern Recognition Receptors
  4. C-type Lectin Receptors
  5. CLEC14A
  6. CLEC14A Protein, Rat (HEK293, Fc)

CLEC14A Protein, Rat (HEK293, Fc) is the recombinant rat-derived CLEC14A protein, expressed by HEK293, with C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
무료 샘플   Apply now
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

CLEC14A Protein, Rat (HEK293, Fc) is the recombinant rat-derived CLEC14A protein, expressed by HEK293, with C-hFc labeled tag.

Background

The C-type agglutinin-like receptors (CLECs) family consists of different transmembrane pattern recognition receptors. CLECs play a key role in regulating cancer cell growth, maintaining hemostasis and promoting cell communication. CLEC14A is a type I transmembrane protein belonging to the C-type lectin superfamily that mediates intercellular adhesion, inflammatory response, and apoptosis. CLEC14A contributes to the germination and stability of blood vessels during angiogenesis and the formation of normal lymphatic sacs and blood vessels by regulating the expression levels and signaling of VEGFR-3 and VEGFR-2. CLEC14A is upregulated in hepatocellular carcinoma and may serve as a potential diagnostic biomarker[1][2][3].

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Rat CLEC14A at 1 µg/mL can bind Mouse VEGF R3. The ED50 for this effect is 1.457 μg/mL.

Species

Rat

Source

HEK293

Tag

C-hFc

Accession

Q642B4 (E22-T398)

Gene ID
Molecular Construction
N-term
CLEC14A (E22-T398)
Accession # Q642B4
hFc
C-term
Protein Length

Partial

Synonyms
C-type lectin domain family 14 member A; EGFR-5; C14orf27
AA Sequence

MRPALALCLLCPAFWPRPGNGEHPTADRAVCSVPGACYSLHHAAMKRRAAEEACSLRGGTLSTVQSGSELQAVLKLFRAGPGPGGGSKDLMFWVALERDRSQCTQEREPLRGFSWLYTDSEDSENRTLPWVEEPQLSCTVRKCAVLQATGGVEPAGWKEMRCQQRADGYLCKYQFEALCPAPRPGAASNLSFQAPFRLSSSALDFSPPGTEVSAMCPRDFSVSSICVQEETGARWDGLFPGSLLCPCSGRYLLAGKCVELADCLDYLGNFACECAVGFELGKDKRSCETKAEGQLTLEGTKLPTRNVSATPASPVTNKSWPGQVYDKPGEMPQVTGQDRIATSVPEILQWGTQSTLPTVQTSPQTKPKVTITPSGSMMPTLNFASSPPVSLTFDSSST

분자량

Approximately 90-120 kDa due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

CLEC14A Protein, Rat (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

CLEC14A Protein, Rat (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
CLEC14A Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P76829
수량:
MCE Japan Authorized Agent: