Copy Link Print Information

CLEC4C Protein, Human (HEK293, His, Myc)

Customer Review

Based on 1 Customer Validation

CLEC4C is a lectin-type cell surface receptor that plays a crucial role in antigen capture by dendritic cells. It specifically recognizes non-sialylated galactose-terminated biantennary glycans with the trisaccharide epitope Gal(beta1-3/4)GlcNAc(beta1-2)Man. CLEC4C Protein, Human (HEK293, His, Myc) is the recombinant human-derived CLEC4C protein, expressed by HEK293 , with N-6*His, N-Myc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for CLEC4C Protein, Human (HEK293, His, Myc)
  • Experimental Validation Results for CLEC4C Protein, Human (HEK293, His, Myc)
  • CLEC4C Protein, Human (HEK293, His, Myc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CLEC4C is a lectin-type cell surface receptor that plays a crucial role in antigen capture by dendritic cells. It specifically recognizes non-sialylated galactose-terminated biantennary glycans with the trisaccharide epitope Gal(beta1-3/4)GlcNAc(beta1-2)Man. CLEC4C Protein, Human (HEK293, His, Myc) is the recombinant human-derived CLEC4C protein, expressed by HEK293 , with N-6*His, N-Myc labeled tag.

Background

The CLEC4C protein functions as a lectin-type cell surface receptor and is implicated in antigen capturing by dendritic cells. It specifically recognizes non-sialylated galactose-terminated biantennary glycans that contain the trisaccharide epitope Gal(beta1-3/4)GlcNAc(beta1-2)Man. Additionally, CLEC4C binds to serum IgG and efficiently targets ligands into antigen-processing and peptide-loading compartments for presentation to T-cells. Notably, it may mediate potent inhibition of the induction of IFN-alpha/beta expression in plasmacytoid dendritic cells and act as a signaling receptor, activating protein-tyrosine kinases and mobilizing intracellular calcium. The protein forms homodimers, underscoring its potential significance in cellular signaling and immune response modulation.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human CLEC4C at 2 μg/mL (100 μL/well) on the plate can bind CLEC4C antibody. The ED50 for this effect is 9.037 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-6*His;N-Myc
  • Accession

    Q8WTT0-1 (N45-I213)

  • Gene ID
    170482  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His-Myc
    • CLEC4C (N45-I213)
      Accession # Q8WTT0-1
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CLEC4C; Dendritic Lectin; Prev. CLECSF11; C-Type (Calcium Dependent, Carbohydrate-Recognition Domain) Lectin, Superfamily Member 11; Prev. CLECSF7; C-Type Lectin Domain Family 4, Member C; BDCA2; Blood Dendritic Cell Antigen 2 Protein; HECL; Blood Dendrit

  • AA Sequence

    NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI

  • Predicted Molecular Mass

    22 kDa

  • Molecular Weight

    Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 6% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized Human CLEC4C at 2 μg/mL (100 μL/well) on the plate can bind CLEC4C antibody. The ED50 for this effect is 9.037 ng/mL.

  • CLEC4C Protein, Human (HEK293, His, Myc) Product Image
    1/16
  • Experimental Validation Results for CLEC4C Protein, Human (HEK293, His, Myc)
  • Experimental Validation Results for CLEC4C Protein, Human (HEK293, His, Myc)
  • CLEC4C Protein, Human (HEK293, His, Myc) Product Image