1. Recombinant Proteins
  2. Receptor Proteins
  3. Pattern Recognition Receptors
  4. C-type Lectin Receptors
  5. BDCA-2
  6. CLEC4C Protein, Human (HEK293, His)

CLEC4C Protein, Human (HEK293, His)

Cat. No.: HY-P71679
Handling Instructions

CLEC4C is a lectin-type cell surface receptor that plays a crucial role in antigen capture by dendritic cells. It specifically recognizes non-sialylated galactose-terminated biantennary glycans with the trisaccharide epitope Gal(beta1-3/4)GlcNAc(beta1-2)Man. CLEC4C Protein, Human (HEK293, His) is the recombinant human-derived CLEC4C protein, expressed by HEK293 , with N-His labeled tag. The total length of CLEC4C Protein, Human (HEK293, His) is 169 a.a., with molecular weight of ~24.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CLEC4C is a lectin-type cell surface receptor that plays a crucial role in antigen capture by dendritic cells. It specifically recognizes non-sialylated galactose-terminated biantennary glycans with the trisaccharide epitope Gal(beta1-3/4)GlcNAc(beta1-2)Man. CLEC4C Protein, Human (HEK293, His) is the recombinant human-derived CLEC4C protein, expressed by HEK293 , with N-His labeled tag. The total length of CLEC4C Protein, Human (HEK293, His) is 169 a.a., with molecular weight of ~24.0 kDa.

Background

The CLEC4C protein functions as a lectin-type cell surface receptor and is implicated in antigen capturing by dendritic cells. It specifically recognizes non-sialylated galactose-terminated biantennary glycans that contain the trisaccharide epitope Gal(beta1-3/4)GlcNAc(beta1-2)Man. Additionally, CLEC4C binds to serum IgG and efficiently targets ligands into antigen-processing and peptide-loading compartments for presentation to T-cells. Notably, it may mediate potent inhibition of the induction of IFN-alpha/beta expression in plasmacytoid dendritic cells and act as a signaling receptor, activating protein-tyrosine kinases and mobilizing intracellular calcium. The protein forms homodimers, underscoring its potential significance in cellular signaling and immune response modulation.

Species

Human

Source

HEK293

Tag

N-His

Accession

Q8WTT0 (N45-I213)

Gene ID
Molecular Construction
N-term
His
CLEC4C (N45-I213)
Accession # Q8WTT0
C-term
Synonyms
CLEC4C; BDCA2; CLECSF11; CLECSF7; DLEC; HECL; UNQ9361/PRO34150C-type lectin domain family 4 member C; Blood dendritic cell antigen 2; BDCA-2; C-type lectin superfamily member 7; Dendritic lectin; CD antigen CD303
AA Sequence

NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI

Molecular Weight

Approximately 24.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CLEC4C Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CLEC4C Protein, Human (HEK293, His)
Cat. No.:
HY-P71679
Quantity:
MCE Japan Authorized Agent: