1. Recombinant Proteins
  2. Receptor Proteins
  3. Pattern Recognition Receptors
  4. C-type Lectin Receptors
  5. Macrophage-inducible C-type Lectin/CLEC4E
  6. CLEC4E Protein, Human (HEK293, His)

The CLEC4E protein is a calcium-dependent lectin that functions as a pattern recognition receptor in the immune system.It detects and binds DAMPs and PAMPs, including α-mannose residues on mycobacterial TDM and fungi.CLEC4E Protein, Human (HEK293, His) is the recombinant human-derived CLEC4E protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CLEC4E protein is a calcium-dependent lectin that functions as a pattern recognition receptor in the immune system.It detects and binds DAMPs and PAMPs, including α-mannose residues on mycobacterial TDM and fungi.CLEC4E Protein, Human (HEK293, His) is the recombinant human-derived CLEC4E protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CLEC4E Protein is a calcium-dependent lectin that serves as a pattern recognition receptor (PRR) in the innate immune system. It is responsible for detecting and binding to damage-associated molecular patterns (DAMPs) of abnormal self and pathogen-associated molecular patterns (PAMPs) found in bacteria and fungi. Notably, it can recognize mycobacterial trehalose 6,6'-dimycolate (TDM), a glycolipid with potent immunomodulatory functions. In myeloid cells, CLEC4E interacts with the signaling adapter Fc receptor gamma chain/FCER1G to form a functional complex. Binding of TDM to this receptor complex triggers phosphorylation of the immunoreceptor tyrosine-based activation motif (ITAM) of FCER1G, leading to activation of SYK, CARD9, and NF-kappa-B. This ultimately drives the maturation of antigen-presenting cells and shapes antigen-specific priming of T-cells towards effector T-helper 1 and T-helper 17 cell subtypes. CLEC4E also recognizes alpha-mannose residues on pathogenic fungi, such as Malassezia, and mediates macrophage activation. Additionally, CLEC4E enables immune sensing of damaged self by recognizing DAMPs released during nonhomeostatic cell death, thereby promoting inflammatory cell infiltration into the damaged tissue. CLEC4E can exist as a monomer or homodimer and interacts directly with FCER1G to form a functional complex. Alternatively, it acts as a bridge for interaction between CLEC4D and FCER1G. Furthermore, CLEC4E can directly interact with SAP130 nuclear protein, which is released from necrotic cells.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9ULY5 (R41-L219)

Gene ID
Molecular Construction
N-term
CLEC4E (R41-L219)
Accession # Q9ULY5
6*His
C-term
Protein Length

Extracellular Domain

Synonyms
rHuC-Type Lectin Domain Family 4 Member E/CLEC4E, His; C-Type Lectin Domain Family 4 Member E; C-Type Lectin Superfamily Member 9; Macrophage-Inducible C-Type Lectin; CLEC4E; CLECSF9; MINCLE
AA Sequence

RCVVTFRIFQTCDEKKFQLPENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGINPLNKGKSL

Molecular Weight

Approximately 26.0 kDa

Glycosylation
Yes
Purity

Greater than 90% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CLEC4E Protein, Human (HEK293, His)
Cat. No.:
HY-P70118
Quantity:
MCE Japan Authorized Agent: