CLEC4E Protein, Human (HEK293, His)
Based on 1 Customer Validation
The CLEC4E protein is a calcium-dependent lectin that functions as a pattern recognition receptor in the immune system.It detects and binds DAMPs and PAMPs, including α-mannose residues on mycobacterial TDM and fungi.CLEC4E Protein, Human (HEK293, His) is the recombinant human-derived CLEC4E protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The CLEC4E protein is a calcium-dependent lectin that functions as a pattern recognition receptor in the immune system.It detects and binds DAMPs and PAMPs, including α-mannose residues on mycobacterial TDM and fungi.CLEC4E Protein, Human (HEK293, His) is the recombinant human-derived CLEC4E protein, expressed by HEK293 , with C-6*His labeled tag.
Background
CLEC4E Protein is a calcium-dependent lectin that serves as a pattern recognition receptor (PRR) in the innate immune system. It is responsible for detecting and binding to damage-associated molecular patterns (DAMPs) of abnormal self and pathogen-associated molecular patterns (PAMPs) found in bacteria and fungi. Notably, it can recognize mycobacterial trehalose 6,6'-dimycolate (TDM), a glycolipid with potent immunomodulatory functions. In myeloid cells, CLEC4E interacts with the signaling adapter Fc receptor gamma chain/FCER1G to form a functional complex. Binding of TDM to this receptor complex triggers phosphorylation of the immunoreceptor tyrosine-based activation motif (ITAM) of FCER1G, leading to activation of SYK, CARD9, and NF-kappa-B. This ultimately drives the maturation of antigen-presenting cells and shapes antigen-specific priming of T-cells towards effector T-helper 1 and T-helper 17 cell subtypes. CLEC4E also recognizes alpha-mannose residues on pathogenic fungi, such as Malassezia, and mediates macrophage activation. Additionally, CLEC4E enables immune sensing of damaged self by recognizing DAMPs released during nonhomeostatic cell death, thereby promoting inflammatory cell infiltration into the damaged tissue. CLEC4E can exist as a monomer or homodimer and interacts directly with FCER1G to form a functional complex. Alternatively, it acts as a bridge for interaction between CLEC4D and FCER1G. Furthermore, CLEC4E can directly interact with SAP130 nuclear protein, which is released from necrotic cells.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9ULY5 (R41-L219)
-
Molecular Construction
-
N-term
-
CLEC4E (R41-L219)
Accession # Q9ULY5 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CLEC4E; Macrophage-Inducible C-Type Lectin; Prev. CLECSF9; C-Type Lectin Superfamily Member 9; MINCLE; C-Type Lectin Domain Family 4, Member E; C-Type Lectin Domain Family 4 Member E; C-Type (Calcium Dependent, Carbohydrate-Recognition Domain) Lectin, Sup
-
AA Sequence
RCVVTFRIFQTCDEKKFQLPENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGINPLNKGKSL
-
Predicted Molecular Mass
21.7 kDa
-
Molecular Weight
Approximately 26 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)