CLEC4E Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

The CLEC4E protein is a calcium-dependent lectin that functions as a pattern recognition receptor in the immune system.It detects and binds DAMPs and PAMPs, including α-mannose residues on mycobacterial TDM and fungi.CLEC4E Protein, Human (HEK293, His) is the recombinant human-derived CLEC4E protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CLEC4E protein is a calcium-dependent lectin that functions as a pattern recognition receptor in the immune system.It detects and binds DAMPs and PAMPs, including α-mannose residues on mycobacterial TDM and fungi.CLEC4E Protein, Human (HEK293, His) is the recombinant human-derived CLEC4E protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CLEC4E Protein is a calcium-dependent lectin that serves as a pattern recognition receptor (PRR) in the innate immune system. It is responsible for detecting and binding to damage-associated molecular patterns (DAMPs) of abnormal self and pathogen-associated molecular patterns (PAMPs) found in bacteria and fungi. Notably, it can recognize mycobacterial trehalose 6,6'-dimycolate (TDM), a glycolipid with potent immunomodulatory functions. In myeloid cells, CLEC4E interacts with the signaling adapter Fc receptor gamma chain/FCER1G to form a functional complex. Binding of TDM to this receptor complex triggers phosphorylation of the immunoreceptor tyrosine-based activation motif (ITAM) of FCER1G, leading to activation of SYK, CARD9, and NF-kappa-B. This ultimately drives the maturation of antigen-presenting cells and shapes antigen-specific priming of T-cells towards effector T-helper 1 and T-helper 17 cell subtypes. CLEC4E also recognizes alpha-mannose residues on pathogenic fungi, such as Malassezia, and mediates macrophage activation. Additionally, CLEC4E enables immune sensing of damaged self by recognizing DAMPs released during nonhomeostatic cell death, thereby promoting inflammatory cell infiltration into the damaged tissue. CLEC4E can exist as a monomer or homodimer and interacts directly with FCER1G to form a functional complex. Alternatively, it acts as a bridge for interaction between CLEC4D and FCER1G. Furthermore, CLEC4E can directly interact with SAP130 nuclear protein, which is released from necrotic cells.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CLEC4E (R41-L219)
      Accession # Q9ULY5
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CLEC4E; Macrophage-Inducible C-Type Lectin; Prev. CLECSF9; C-Type Lectin Superfamily Member 9; MINCLE; C-Type Lectin Domain Family 4, Member E; C-Type Lectin Domain Family 4 Member E; C-Type (Calcium Dependent, Carbohydrate-Recognition Domain) Lectin, Sup

  • AA Sequence

    RCVVTFRIFQTCDEKKFQLPENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGINPLNKGKSL

  • Predicted Molecular Mass

    21.7 kDa

  • Molecular Weight

    Approximately 26 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00