CXCL15 Protein, Mouse (HEK293, His)

CXCL15, also known as Lungkine or WECHE, is a member of the ELR motif-containing CXC chemokines. CXCL15 has neutrophil chemotactic activity. CXCL15 is high expression in the lungs of mice^[1][2]. CXCL15 Protein, Mouse (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 142 amino acids (Q26-A167).

CXCL15 (Lungkine) is an ELR+ CXC chemokines described in the developing lung with neutrophil chemotactic properties. CXCL15 has activities associated with immunology and host defense systems^[1][2].

Recombinant mouse CXCL15 (5-20 ng/mL; for 4 days) decreases numbers of functional hematopoietic progenitor cells during cytokine-enhanced ex-vivo culture of lineage negative mouse bone marrow cells. Moreover, CXCL15, through S-Phase specific actions, is able to suppress in vitro colony formation of normal wildtype mouse bone marrow granulocyte macrophage (CFU-GM), granulocyte (CFU-G), macrophage (CFU-M), BFU-E, and multipotential (CFU-GEM)^[1].

Recombinant mouse CXCL15 (200 ng/mouse; i.p.; once) increases migration of polymorphonuclear myeloid-derived suppressor cells (PMN-MDSCs) only in the isotype control group, but not in mice that received CXCR2 blockade^[4].

Mouse

HEK293

C-6*His

Q9WVL7 (Q26-A167)

20309  [NCBI]

QELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLTGSDA

20-22 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Hal E Broxmeyer, et al. CXCL15/Lungkine has suppressive activity on proliferation and expansion of multi-potential, erythroid, granulocyte and macrophage progenitors in S-phase specific manner. Blood Cells Mol Dis. 2021 Nov;91:102594.  [Content Brief]

  [2]. James J Zhu, et al. A novel bovine CXCL15 gene in the GRO chemokine gene cluster. Vet Immunol Immunopathol. 2020 Feb;220:109990.  [Content Brief]

  [3]. Julia M Schmitz, et al. Expression of CXCL15 (Lungkine) in murine gastrointestinal, urogenital, and endocrine organs. J Histochem Cytochem. 2007 May;55(5):515-24.  [Content Brief]

  [4]. Zoila A Lopez-Bujanda, et al. Castration-mediated IL-8 promotes myeloid infiltration and prostate cancer progression. Nat Cancer. 2021 Aug;2(8):803-818.  [Content Brief]