1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. CXCL15
  6. CXCL15 Protein, Mouse (HEK293, His)

CXCL15, also known as Lungkine or WECHE, is a member of the ELR motif-containing CXC chemokines. CXCL15 has neutrophil chemotactic activity. CXCL15 is high expression in the lungs of mice. CXCL15 Protein, Mouse (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 142 amino acids (Q26-A167).

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
10 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

CXCL15, also known as Lungkine or WECHE, is a member of the ELR motif-containing CXC chemokines. CXCL15 has neutrophil chemotactic activity. CXCL15 is high expression in the lungs of mice[1][2]. CXCL15 Protein, Mouse (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 142 amino acids (Q26-A167).

Background

CXCL15 (Lungkine) is an ELR+ CXC chemokines described in the developing lung with neutrophil chemotactic properties. CXCL15 has activities associated with immunology and host defense systems[1][2].

In Vitro

Recombinant mouse CXCL15 (5-20 ng/mL; for 4 days) decreases numbers of functional hematopoietic progenitor cells during cytokine-enhanced ex-vivo culture of lineage negative mouse bone marrow cells. Moreover, CXCL15, through S-Phase specific actions, is able to suppress in vitro colony formation of normal wildtype mouse bone marrow granulocyte macrophage (CFU-GM), granulocyte (CFU-G), macrophage (CFU-M), BFU-E, and multipotential (CFU-GEM)[1].

In Vivo

Recombinant mouse CXCL15 (200 ng/mouse; i.p.; once) increases migration of polymorphonuclear myeloid-derived suppressor cells (PMN-MDSCs) only in the isotype control group, but not in mice that received CXCR2 blockade[4].

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q9WVL7 (Q26-A167)

Gene ID

20309  [NCBI]

Molecular Construction
N-term
CXCL15 (Q26-A167)
Accession # Q9WVL7
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
C-X-C motif chemokine 15; Lungkine; CXCL15; Scyb15
AA Sequence

QELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLTGSDA

분자량

20-22 kDa

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
References

CXCL15 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

CXCL15 Protein, Mouse (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
CXCL15 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P72682
수량:
MCE Japan Authorized Agent: