CXCL15 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
CXCL15, also known as Lungkine or WECHE, is a member of the ELR motif-containing CXC chemokines. CXCL15 has neutrophil chemotactic activity. CXCL15 is high expression in the lungs of mice. CXCL15 Protein, Mouse (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 142 amino acids (Q26-A167).
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
CXCL15, also known as Lungkine or WECHE, is a member of the ELR motif-containing CXC chemokines. CXCL15 has neutrophil chemotactic activity. CXCL15 is high expression in the lungs of mice[1][2]. CXCL15 Protein, Mouse (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 142 amino acids (Q26-A167).
Background
CXCL15 (Lungkine) is an ELR+ CXC chemokines described in the developing lung with neutrophil chemotactic properties. CXCL15 has activities associated with immunology and host defense systems[1][2].
In Vitro
Recombinant mouse CXCL15 (5-20 ng/mL; for 4 days) decreases numbers of functional hematopoietic progenitor cells during cytokine-enhanced ex-vivo culture of lineage negative mouse bone marrow cells. Moreover, CXCL15, through S-Phase specific actions, is able to suppress in vitro colony formation of normal wildtype mouse bone marrow granulocyte macrophage (CFU-GM), granulocyte (CFU-G), macrophage (CFU-M), BFU-E, and multipotential (CFU-GEM)[1].
In Vivo
Recombinant mouse CXCL15 (200 ng/mouse; i.p.; once) increases migration of polymorphonuclear myeloid-derived suppressor cells (PMN-MDSCs) only in the isotype control group, but not in mice that received CXCR2 blockade[4].
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9WVL7 (Q26-A167)
-
Gene ID20309 [NCBI]
-
Molecular Construction
-
N-term
-
CXCL15 (Q26-A167)
Accession # Q9WVL7 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
C-X-C motif chemokine 15; Lungkine; Small-inducible cytokine B15; Cxcl15; Scyb15
-
AA Sequence
QELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLTGSDA
-
Predicted Molecular Mass
17.4 kDa
-
Molecular Weight
Approximately 20-22 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Hal E Broxmeyer, et al. CXCL15/Lungkine has suppressive activity on proliferation and expansion of multi-potential, erythroid, granulocyte and macrophage progenitors in S-phase specific manner. Blood Cells Mol Dis. 2021 Nov;91:102594. [Content Brief]
[2]. James J Zhu, et al. A novel bovine CXCL15 gene in the GRO chemokine gene cluster. Vet Immunol Immunopathol. 2020 Feb;220:109990. [Content Brief]
[3]. Julia M Schmitz, et al. Expression of CXCL15 (Lungkine) in murine gastrointestinal, urogenital, and endocrine organs. J Histochem Cytochem. 2007 May;55(5):515-24. [Content Brief]
[4]. Zoila A Lopez-Bujanda, et al. Castration-mediated IL-8 promotes myeloid infiltration and prostate cancer progression. Nat Cancer. 2021 Aug;2(8):803-818. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
