MIG/CXCL9 Protein, Mouse (HEK293, His)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

CXCL9, also known as MIG, is one member of the ELR-negative CXC chemokine subfamily, and can be induced by IFN-γ. CXCL9 binds to its receptor CXCR3 and can recruit CXCR3+ cells, such as effector T cells, regulatory T cells (Tregs) and CD8+ cytotoxic T cells. CXCL9 is involved in immunoregulatory and inflammatory processes, but it also play a key role in tumor growth, angiogenesis, and metastasis. MIG/CXCL9 Protein, Mouse (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

CXCL9, also known as MIG, is one member of the ELR-negative CXC chemokine subfamily, and can be induced by IFN-γ. CXCL9 binds to its receptor CXCR3 and can recruit CXCR3+ cells, such as effector T cells, regulatory T cells (Tregs) and CD8+ cytotoxic T cells. CXCL9 is involved in immunoregulatory and inflammatory processes, but it also play a key role in tumor growth, angiogenesis, and metastasis[1][2]. MIG/CXCL9 Protein, Mouse (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags.

Background

CXCL9 is a member of the CXC family and has an important role in the chemotaxis of immune cells. It is secreted by various cell types including immune cells (T lymphocytes, NK cells, dendritic cells, macrophages, eosinophils, etc.), and non-immune cells (hepatic stellate cells, preadipocytes, thyrocytes, endothelial cell, tumor cells, and fibroblasts, etc)[1].
The amino acid sequence of human CXCL9 protein has low homology between mouse and rat CXCL9 protein.
CXCL9 is one of the ligands of chemokine receptor CXCR3 that mediates the infiltration of lymphocytes to focal sites and suppresses tumor growth. CXCL9 attracts CXCR3- (CXCR3-A and CXCR3-B) T lymphocytes, is involved in the pathogenesis of a variety of physiologic diseases during their initiation and their maintenance. The transcriptional regulation of CXCL9 is a multistep process involving many transcription factors, of which STAT1 and NF-κB are two most well-characterized members. Both the gene mutation of STAT1 and the blocking of the JA/STAT1 pathway can reduce CXCL9 expression induced by IFN-γ. Moreover, CXCL9 expression can be suppressed by reducing the levels of components of the STAT1-IRF-1 transcriptional activation pathway by Porphyromonas gingivalis that leads to the immune function decline. Lipopolysaccharide (LPS) and D-galactosamine could induce the phosphorylation of STAT1 and enhance the transcription of CXCL9 leading to the enhancement of liver inflammation, and even liver apoptosis and injury[1][2][3].
CXCL9 could promote cancer metastasis via enhanced migration and invasion of tumor cells, and breaking of the endothelial cells monolayer. However, as a tumor suppressor, it mainly recruited tumor-infiltrating CD8+ T cells and NK cells, and inhibited tumor angiogenesis. In Addition, IL-12 and Th1-derived IFN-γ exerted antitumor effects through the inhibitory effects of endogenous CXCL9 on tumor vasculature in human Burkitt's lymphoma. In cutaneous T-cell lymphoma, expression of CXCL9 was found at early stage but low at advanced stage. CXCL9 is also associated with human hepatic fibrosis and anti-fibrosis in mice. Furthermore, CXCL9 is highly expressed in atherosclerotic plaques of coronary arteries and specifically recruits CXCR3-bearing Th1 cells that increase the risk of plaque progression and the occurrences of myocardial infarction[1][2][3][4].

In Vitro

Recombinant mouse CXCL9 (10 mg/kg; for 4 weeks) is intraperitoneally injected three times a week in the orthotopic murine pancreatic adenocarcinoma (PAAD) model. CXCL9 could significant accelerate the growth of PAAD tumour. CXCL9 promotes PAAD progression and suppresses CD8+ cytotoxic T cells in tumour tissues[4].

In Vivo

Recombinant mouse CXCL9 (100 ng/mL) displays strong antiproliferative and antimigratory effects on VEGF-stimulated endothelial cells and stellate cells by way of reduced VEGFR2 (KDR), phospholipase Cγ (PLCγ), and extracellular signal-regulated kinase (ERK) phosphorylation[5].

Verified Bioactivity

1.Measured by its ability to chemoattract THP-1 human peripheral blood T-lymphocytes. The ED50 for this effect is 85.56 ng/mL, corresponding to a specific activity is 1.169×104 U/mg.
2. Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with Mouse CXCR3. The ED50 for this effect is 0.1-0.3 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with Mouse CXCR3. The ED50 for this effect is 0.1845 μg/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CXCL9 (T22-T126)
      Accession # P18340
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CXCL9; Monokine Induced By Interferon-Gamma; Prev. CMK; Chemokine (C-X-C Motif) Ligand 9; Prev. MIG; Small-Inducible Cytokine B9; SCYB9; C-X-C Motif Chemokine 9; Crg-10; Alternative Protein CXCL9; Humig; HuMIG; Monokine Induced By Gamma Interferon; C-X-C

  • AA Sequence

    TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKISQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT

  • Predicted Molecular Mass

    12.2 kDa

  • Molecular Weight

    Approximately 18-28 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00