CYB5R1 Protein, Human (His)
Based on 1 Customer Validation
CYB5R1 is an important member of the NADH-cytochrome b5 reductase family and plays a crucial role in fatty acid desaturation, cholesterol biosynthesis, drug metabolism, and erythrocyte methemoglobin reduction. Utilizing NADH, CYB5R1 promotes the reduction of cytochrome b5, contributing to enzymatic processes in lipid metabolism, sterol synthesis, and drug biotransformation. CYB5R1 Protein, Human (His) is the recombinant human-derived CYB5R1 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CYB5R1 is an important member of the NADH-cytochrome b5 reductase family and plays a crucial role in fatty acid desaturation, cholesterol biosynthesis, drug metabolism, and erythrocyte methemoglobin reduction. Utilizing NADH, CYB5R1 promotes the reduction of cytochrome b5, contributing to enzymatic processes in lipid metabolism, sterol synthesis, and drug biotransformation. CYB5R1 Protein, Human (His) is the recombinant human-derived CYB5R1 protein, expressed by E. coli , with N-His labeled tag.
Background
CYB5R1, a member of the NADH-cytochrome b5 reductase family, plays a crucial role in diverse biological processes such as fatty acid desaturation and elongation, cholesterol biosynthesis, drug metabolism, and methemoglobin reduction in erythrocytes. As an essential component of these metabolic pathways, CYB5R1 utilizes NADH as a cofactor to facilitate the reduction of cytochrome b5, contributing to the enzymatic processes involved in lipid metabolism, sterol synthesis, and drug biotransformation. In erythrocytes, CYB5R1's involvement in methemoglobin reduction underscores its significance in maintaining hemoglobin functionality and preventing oxidative stress. The multifunctional nature of CYB5R1 positions it as a key player in cellular processes crucial for lipid homeostasis, hemoglobin function, and drug metabolism.
Verified Bioactivity
Measured by its ability to combine with the NADPH produces the H2O2. The specific activity is 7661.210 pmoL/min/μg, as measured under the described conditions.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q9UHQ9 (L29-Y305)
-
Molecular Construction
-
N-term
-
His
-
CYB5R1 (L29-Y305)
Accession # Q9UHQ9 -
C-term
-
-
Protein Length
Partial
-
Synonyms
CYB5R1; NADH-Cytochrome B5 Reductase 1; Prev. NQO3A2; NAD(P)H:Quinone Oxidoreductase Type 3 Polypeptide A2; Humb5R2; B5R1; NAD(P)H:Quinone Oxidoreductase Type 3, Polypeptide A2; B5R2; Cytochrome B5 Reductase 1; B5R.1
-
AA Sequence
LVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHNTKRFRFALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKVGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLGMIAGGTGITPMLQLIRAILKVPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLWFTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLACHPNLDKLGYSQKMRFTY
-
Molecular Weight
Approximately 34 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
