EFNB2A Protein, zebrafish (HEK293, His)

The EFNB2A protein is a cell surface ligand of the Eph receptor that critically regulates migration, repulsion, and adhesion in neuronal, vascular, and epithelial development. EFNB2A Protein, zebrafish (HEK293, His) is the recombinant EFNB2A protein, expressed by HEK293 , with C-His labeled tag.

EFNB2A, a cell surface transmembrane ligand for Eph receptors, plays a crucial role in neuronal, vascular, and epithelial development by binding promiscuously to Eph receptors on adjacent cells. This interaction initiates contact-dependent bidirectional signaling into neighboring cells, with forward signaling occurring downstream of the receptor and reverse signaling downstream of the ephrin ligand. EFNB2A, together with EphB4, may hold significance in heart morphogenesis and angiogenesis by regulating cell adhesion and migration. The protein's binding to the receptor tyrosine kinase EphB4 highlights its involvement in these essential developmental processes.

Immobilized zebrafish EFNB2A at 10 µg/mL (100 µL/well) can bind Biotinylated human EphB4. The ED₅₀ for this effect is 31.44 ng/mL.

• 
  Immobilized zebrafish EFNB2A at 10 µg/mL (100 µL/well) can bind Biotinylated human EphB4. The ED₅₀ for this effect is 31.44 ng/mL.

Others

HEK293

C-His

O73874 (L25-A222)

30219  [NCBI]

Extracellular Domain

LILDSIYWNTTNTKFVPGQGLVLYPQIGDKMDIVCPRVEGGSMEGVEYYKLYMVPLEQLKSCQVTKADTPLLNCVKPDQDVKFTLKFQEFSPNLWGLEFFRGKDYYIISTSNGTMEGLDNQEGGVCKTKSMKIIMKVGQNPSDPISPKDYPTSYPPKHPDLGGKDSKSNEVLKPDASPHGEDKGDGNKSSSVIGSEVA

Approximately 30-40 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, PH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.