EphA3 Protein, Mouse (HEK293, Fc)

The EphA3 protein is a receptor tyrosine kinase that promiscuously binds to membrane-bound ephrin ligands to initiate bidirectional signaling. Activation of EphA3 is known to preferentially bind to EFNA5 and regulates cell-cell adhesion, cytoskeletal organization, and migration. EphA3 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived EphA3 protein, expressed by HEK293 , with C-hFc labeled tag.

The EphA3 protein, a receptor tyrosine kinase, engages in promiscuous binding to membrane-bound ephrin family ligands on adjacent cells, initiating contact-dependent bidirectional signaling. The downstream pathway originating from the receptor is known as forward signaling, while the pathway downstream of the ephrin ligand is termed reverse signaling. Highly promiscuous for ephrin-A ligands, EphA3 exhibits a preferential binding affinity for EFNA5. Upon activation by EFNA5, EphA3 plays a pivotal role in regulating cell-cell adhesion, cytoskeletal organization, and cell migration. Additionally, EphA3 is implicated in cardiac cell migration and differentiation, regulating the formation of the atrioventricular canal and septum during development, likely through activation by EFNA1. In the context of retinotectal mapping, EphA3 is involved in the guidance of neurons. Furthermore, EphA3 may control the segregation, though not the guidance, of motor and sensory axons during neuromuscular circuit development.

Mouse

HEK293

C-hFc

Q8BRB1 (M1-H541)

13837  [NCBI]

Partial

MDCHLSILVLLGCCVLSCSGELSPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDEHYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETFNLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFYLAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWLVPIGKCTCNAGYEERGFICQACRPGFYKASDGAAKCAKCPPHSSTQEDGSMNCRCENNYFRAEKDPPSMACTRPPSAPRNVISNINETSVILDWSWPLDTGGRKDITFNIICKKCGWNVRQCEPCSPNVRFLPRQLGLTNTTVTVTDLLAHTNYTFEIDAVNGVSELSSPPRQYAAVSITTNQAAPSPVMTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQETSYTILRARGTNVTISSLKPDTTYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGENSH

Approximately 96 kDa,based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.