Ephrin-A2/EFNA2 Protein, Rat (HEK293, Fc)

Ephrin-A2 (EFNA2) is a member of the ephrin family. Ephrin-A2/EFNA2 Protein, Rat (HEK293, Fc) is the recombinant rat-derived Ephrin-A2/EFNA2 protein, expressed by HEK293 , with C-hFc labeled tag.

Ephrin-A2, also known as EFNA2, is a member of the ephrin family of proteins that serves as both a ligand and a receptor, playing a crucial role in cellular communication and tissue development. As a transmembrane protein, Ephrin-A2 engages in bidirectional signaling by interacting with Eph receptors on neighboring cells, triggering intracellular cascades that regulate diverse cellular processes. Ephrin-A2 is particularly implicated in axon guidance during neuronal development, contributing to the precise wiring of the nervous system. Additionally, it plays a role in angiogenesis, influencing vascular development and endothelial cell behavior. The multifaceted functions of Ephrin-A2 underscore its significance in orchestrating complex cellular behaviors and highlight its involvement in various physiological and pathological processes. Understanding the molecular mechanisms controlled by Ephrin-A2 is essential for elucidating its potential implications in neurobiology, cardiovascular development, and other medical contexts.

Measured by its ability to inhibit proliferation of PC-3 human prostate cancer cells. The ED₅₀ for this effect is 26.55 ng/mL, corresponding to a specific activity is 3.766×10⁴ units/mg.

• 
  Measured by its ability to inhibit proliferation of PC-3 human prostate cancer cells. The ED₅₀ for this effect is 26.55 ng/mL, corresponding to a specific activity is 3.766×10⁴ units/mg.

Rat

HEK293

C-hFc

F1MA19 (R21-S183)

84358  [NCBI]

Partial

RNEDPARANADRYAVYWNRSNPRFQVSAVGDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMERYILYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNLVDRPCLRLKVYVRPTNETLYEAPEPIFTS

Approximately 55 kDa.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.