1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Ephrin/Eph Family
  4. Ephrins
  5. Ephrin-A5
  6. Ephrin-A5/EFNA5 Protein, Rhesus Macaque (HEK293, Fc)

Ephrin-A5/EFNA5 Protein, Rhesus Macaque (HEK293, Fc)

Cat. No.: HY-P76321
Handling Instructions Technical Support

Ephrin-A5 (EFNA5) is a member of the ephrin family. Ephrin-A5/EFNA5 Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived Ephrin-A5/EFNA5 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Ephrin-A5 (EFNA5) is a member of the ephrin family. Ephrin-A5/EFNA5 Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived Ephrin-A5/EFNA5 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

Ephrin-A5, also referred to as EFNA5, is a member of the ephrin family of proteins that play pivotal roles in mediating cell-to-cell communication and tissue development. As a transmembrane protein, Ephrin-A5 functions as both a ligand and a receptor, engaging in bidirectional signaling interactions with Eph receptors on adjacent cells. This interaction initiates a cascade of intracellular events that modulate various cellular processes, including cell adhesion, repulsion, and migration. Ephrin-A5 is particularly implicated in neuronal development, where it contributes to axon guidance and synaptic plasticity. Additionally, it plays a role in angiogenesis, influencing vascular development. The diverse functions of Ephrin-A5 underscore its significance in orchestrating complex cellular behaviors and highlight its involvement in various physiological and pathological processes. Gaining insights into the molecular mechanisms governed by Ephrin-A5 is crucial for understanding its potential implications in neurological disorders, developmental biology, and other medical contexts.

Species

Rhesus Macaque

Source

HEK293

Tag

C-hFc

Accession

F7GZC7 (Q21-N203)

Gene ID
Molecular Construction
N-term
EFNA5 (Q21-N203)
Accession # F7GZC7
hFc
C-term
Protein Length

Partial

Synonyms
Ephrin-A5; AL-1; EPH-related receptor tyrosine kinase ligand 7; LERK-7; EFNA5; EPLG7
AA Sequence

QDPGSKTVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN

Predicted Molecular Mass
48.2 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Ephrin-A5/EFNA5 Protein, Rhesus Macaque (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Ephrin-A5/EFNA5 Protein, Rhesus Macaque (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ephrin-A5/EFNA5 Protein, Rhesus Macaque (HEK293, Fc)
Cat. No.:
HY-P76321
Quantity:
MCE Japan Authorized Agent: