Erythropoietin/EPO Protein, Pig (P.pastoris, His)

Erythropoietin (EPO) protein regulates erythrocyte proliferation and differentiation. EPO binds to its receptor (EPOR), inducing EPOR dimerization and activating JAK2. This triggers downstream effectors like STAT1 and STAT3, maintaining erythrocyte mass and homeostasis. Erythropoietin/EPO Protein, Pig (P.pastoris, His) is the recombinant pig-derived Erythropoietin/EPO protein, expressed by P. pastoris , with N-His labeled tag.

Erythropoietin (EPO) protein is a crucial hormone that regulates the proliferation and differentiation of erythrocytes, ensuring a balanced and adequate level of circulating red blood cells. By binding to its receptor (EPOR), EPO induces EPOR dimerization and subsequently activates JAK2, initiating a cascade of events that involve specific downstream effectors such as STAT1 and STAT3. These molecular processes play a pivotal role in maintaining optimal erythrocyte mass and homeostasis within the body.

Pig

P. pastoris

N-His

P49157 (A27-R194)

397249  [NCBI]

Full Length of Mature Protein

APPRLICDSRVLERYILEAKEGENATMGCAESCSFSENITVPDTKVNFYAWKRMEVQQQAMEVWQGLALLSEAILQGQALLANSSQPSEALQLHVDKAVSGLRSLTSLLRALGAQKEAIPLPDASPSSATPLRTFAVDTLCKLFRNYSNFLRGKLTLYTGEACRRRDR

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.