1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Erythropoietin Protein, Cynomolgus (His-SUMO)

Erythropoietin Protein, Cynomolgus (His-SUMO)

Cat. No.: HY-P72186
Handling Instructions Technical Support

Erythropoietin protein (EPO) regulates erythrocyte growth and balance. EPO binding to its receptor (EPOR) triggers EPOR dimerization, activating JAK2. This initiates downstream events involving effectors like STAT1 and STAT3, crucial for erythrocyte proliferation, differentiation, and maintaining optimal blood cell levels. Erythropoietin Protein, Cynomolgus (His-SUMO) is the recombinant cynomolgus-derived Erythropoietin protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

Erythropoietin protein (EPO) regulates erythrocyte growth and balance. EPO binding to its receptor (EPOR) triggers EPOR dimerization, activating JAK2. This initiates downstream events involving effectors like STAT1 and STAT3, crucial for erythrocyte proliferation, differentiation, and maintaining optimal blood cell levels. Erythropoietin Protein, Cynomolgus (His-SUMO) is the recombinant cynomolgus-derived Erythropoietin protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Background

Erythropoietin protein (EPO) plays a crucial role in regulating the growth and maturation of red blood cells, as well as maintaining the appropriate balance of circulating erythrocytes in the body. When EPO binds to its receptor (EPOR), it triggers EPOR dimerization, which in turn activates JAK2, initiating a cascade of events that involve specific downstream effectors such as STAT1 and STAT3. These molecular pathways are essential for ensuring the proper proliferation and differentiation of erythrocytes, as well as maintaining the optimal level of red blood cells in circulation.

Species

Cynomolgus

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

P07865 (A28-R192)

Gene ID
Molecular Construction
N-term
6*His-SUMO
Erythropoietin (A28-R192)
Accession # P07865
C-term
Protein Length

Full Length of Mature Protein

Synonyms
EPOErythropoietin
AA Sequence

APPRLICDSRVLERYLLEAKEAENVTMGCSESCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQAVLANSSQPFEPLQLHMDKAISGLRSITTLLRALGAQEAISLPDAASAAPLRTITADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR

Predicted Molecular Mass
34.2 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

Erythropoietin Protein, Cynomolgus (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Erythropoietin Protein, Cynomolgus (His-SUMO)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Erythropoietin Protein, Cynomolgus (His-SUMO)
Cat. No.:
HY-P72186
수량:
MCE Japan Authorized Agent: