Erythropoietin Protein, Cynomolgus (His-SUMO)

Erythropoietin protein (EPO) regulates erythrocyte growth and balance. EPO binding to its receptor (EPOR) triggers EPOR dimerization, activating JAK2. This initiates downstream events involving effectors like STAT1 and STAT3, crucial for erythrocyte proliferation, differentiation, and maintaining optimal blood cell levels. Erythropoietin Protein, Cynomolgus (His-SUMO) is the recombinant cynomolgus-derived Erythropoietin protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Erythropoietin protein (EPO) plays a crucial role in regulating the growth and maturation of red blood cells, as well as maintaining the appropriate balance of circulating erythrocytes in the body. When EPO binds to its receptor (EPOR), it triggers EPOR dimerization, which in turn activates JAK2, initiating a cascade of events that involve specific downstream effectors such as STAT1 and STAT3. These molecular pathways are essential for ensuring the proper proliferation and differentiation of erythrocytes, as well as maintaining the optimal level of red blood cells in circulation.

Cynomolgus

E. coli

N-6*His;N-SUMO

P07865 (A28-R192)

101925524  [NCBI]

Full Length of Mature Protein

APPRLICDSRVLERYLLEAKEAENVTMGCSESCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQAVLANSSQPFEPLQLHMDKAISGLRSITTLLRALGAQEAISLPDAASAAPLRTITADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.