1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. Fibroblast Growth Factor 21 (FGF-21)
  6. FGF-21 Protein, Mouse

FGF-21 Protein, Mouse emerges as a metabolic hormone involved in the regulation of glucose, lipid, bile acid, and phosphate metabolism.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg Get quote
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

FGF-21 Protein, Mouse emerges as a metabolic hormone involved in the regulation of glucose, lipid, bile acid, and phosphate metabolism.

Background

Fibroblast growth factor (FGF) 21 is a member of the FGF superfamily. It is most closely related to FGF19 and FGF23, sharing 30–35% amino acid sequence homology. The FGF19 subfamily comprises FGF19, FGF21, and FGF23, and all three FGF19 subfamily members have recently emerged as metabolic hormones involved in the regulation of glucose, lipid, bile acid, and phosphate metabolism[1]. FGF21 provides sustained glucose and lipid control, amelioration of insulin resistance, improvements in β-cell function and mass, and beneficial changes in other lipoprotein and cardiovascular risk factor profiles[2].

Biological Activity

1. The ED50 is <0.5 μg/mL as measured by a cell proliferation assay using NIH-3T3 cells in the presence of 1.25 µg/mL mouse Klotho and 10.0 µg/mL heparin, corresponding to a specific activity of >2.0 × 103 units/mg.
2. Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is ≤1.001 μg/mL in the presence of 1 μg/mL Recombinant Human Klotho beta, corresponding to a specific activity is ≥ 989.12 units/mg.

  • Measured in a cell proliferation assay using NIH‑3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 1.001 μg/mL in the presence of 1 μg/mL Recombinant Human Klotho beta, corresponding to a specific activity is 989.12 units/mg.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

Q9JJN1 (A29-S210)

Gene ID
Molecular Construction
N-term
FGF-21 (A29-S210)
Accession # Q9JJN1
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rMuFGF-21; FGF21
AA Sequence

AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS

Molecular Weight

Approximately 20-23 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water or aqueous buffer containing 0.1% BSA.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-21 Protein, Mouse
Cat. No.:
HY-P7173
Quantity:
MCE Japan Authorized Agent: