Copy Link Print Information

FGF-21 Protein, Hamster (HEK293, His)

Customer Review

Based on 1 Customer Validation

FGF21 is a liver factor that signals through the FGF21 receptor in the paraventricular nucleus of the hypothalamus to regulate monosaccharide intake and preference for sweets. FGF21 promotes the progression of non-small cell lung cancer by activating the SIRT1/PI3K/AKT signaling pathway. FGF21 plays an important role in embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF-21 Protein, Hamster (HEK293, His) is the recombinant FGF-21 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Others
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • FGF-21 Protein, Hamster (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FGF21 is a liver factor that signals through the FGF21 receptor in the paraventricular nucleus of the hypothalamus to regulate monosaccharide intake and preference for sweets. FGF21 promotes the progression of non-small cell lung cancer by activating the SIRT1/PI3K/AKT signaling pathway. FGF21 plays an important role in embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF-21 Protein, Hamster (HEK293, His) is the recombinant FGF-21 protein, expressed by HEK293 , with C-His labeled tag.

Background

Fibroblast growth factor 21 is a member of the fibroblast growth factor (FGF) family. FGF family members have a wide range of mitotic and cell survival activities and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. FGF21 is a hepatic factor, a hormone secreted by the liver that signals through FGF21 receptors in the paraventricular nucleus of the hypothalamus to regulate monosaccharide intake and preference for sweets and is associated with reduced dopamine neurotransmission within the nucleus accumbens. FGF21 promotes progression of non-small cell lung cancer by activating the SIRT1/PI3K/AKT signaling pathway[1][2][3][4].

Verified Bioactivity

Hamster FGF21, His Tag immobilized on CM5 Chip can bind Human Beta Klotho, His Tag with an affinity constant of 264.50 nM as determined in SPR assay (Biacore T200).

Technical Parameters

  • Species Others
  • Source HEK293
  • Tag C-His
  • Accession

    XP_005084765.1 (R29-S209)

  • Gene ID
    101842115  [NCBI]
  • Molecular Construction
    • N-term
    • FGF-21 (R29-S209)
      Accession # XP_005084765.1
    • His
    • C-term
  • Protein Length

    Full Length of Fibroblast growth factor Chain

  • Synonyms

    FGF21; FGF-21; Fibroblast Growth Factor 21; FGF; Fibroblast Growth Factor

  • AA Sequence

    RPIPDSSPLLQFGGQVRHRHLYTDDDQDTEAHLEIREDGTVEGTAHRSPESLLELKALKPGVIQILGVKAARFLCQQPDGSLYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQRDAPSQPPASWGPVRFLPVPGLFQPPHDLPGRPAPEPPDVGSSDPLSMVGPLQDGSPSYAS

  • Predicted Molecular Mass

    20.8 kDa

  • Molecular Weight

    Approximately 21-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • FGF-21 Protein, Hamster (HEK293, His) Product Image
    1/16
  • FGF-21 Protein, Hamster (HEK293, His) Product Image