1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. Fibroblast Growth Factor 21 (FGF-21)
  6. FGF-21 Protein, Hamster (HEK293, His)

FGF21 is a liver factor that signals through the FGF21 receptor in the paraventricular nucleus of the hypothalamus to regulate monosaccharide intake and preference for sweets. FGF21 promotes the progression of non-small cell lung cancer by activating the SIRT1/PI3K/AKT signaling pathway. FGF21 plays an important role in embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF-21 Protein, Hamster (HEK293, His) is the recombinant FGF-21 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGF21 is a liver factor that signals through the FGF21 receptor in the paraventricular nucleus of the hypothalamus to regulate monosaccharide intake and preference for sweets. FGF21 promotes the progression of non-small cell lung cancer by activating the SIRT1/PI3K/AKT signaling pathway. FGF21 plays an important role in embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF-21 Protein, Hamster (HEK293, His) is the recombinant FGF-21 protein, expressed by HEK293 , with C-His labeled tag.

Background

Fibroblast growth factor 21 is a member of the fibroblast growth factor (FGF) family. FGF family members have a wide range of mitotic and cell survival activities and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. FGF21 is a hepatic factor, a hormone secreted by the liver that signals through FGF21 receptors in the paraventricular nucleus of the hypothalamus to regulate monosaccharide intake and preference for sweets and is associated with reduced dopamine neurotransmission within the nucleus accumbens. FGF21 promotes progression of non-small cell lung cancer by activating the SIRT1/PI3K/AKT signaling pathway[1][2][3][4].

Biological Activity

Hamster FGF21, His Tag immobilized on CM5 Chip can bind Human Beta Klotho, His Tag with an affinity constant of 264.50 nM as determined in SPR assay (Biacore T200).

Species

Others

Source

HEK293

Tag

C-His

Accession

XP_005084765.1 (R29-S209)

Gene ID

101842115  [NCBI]

Molecular Construction
N-term
FGF-21 (R29-S209)
Accession # XP_005084765.1
His
C-term
Protein Length

Partial

Synonyms
FGF21; Fibroblast Growth Factor 21; FGF-21
AA Sequence

RPIPDSSPLLQFGGQVRHRHLYTDDDQDTEAHLEIREDGTVEGTAHRSPESLLELKALKPGVIQILGVKAARFLCQQPDGSLYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQRDAPSQPPASWGPVRFLPVPGLFQPPHDLPGRPAPEPPDVGSSDPLSMVGPLQDGSPSYAS

Predicted Molecular Mass
21.2 kDa
Molecular Weight

Approximately 21-30 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FGF-21 Protein, Hamster (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

FGF-21 Protein, Hamster (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-21 Protein, Hamster (HEK293, His)
Cat. No.:
HY-P75762
Quantity:
MCE Japan Authorized Agent: