FGF-21 Protein, Human (CHO, His)
Based on 1 Customer Validation
FGF-21 Protein, Human (CHO, His) is a polypeptide chain containing the C-termimal His tag produced in CHO cells.FGF-21 Protein, Human (CHO, His) is a member of the fibroblast growth factor (FGF) subfamily, acts as a metabolic regulator with pleiotropic effects.
- Species: Human
- Source: CHO
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
FGF-21 Protein, Human (CHO, His) is a polypeptide chain containing the C-termimal His tag produced in CHO cells.FGF-21 Protein, Human (CHO, His) is a member of the fibroblast growth factor (FGF) subfamily, acts as a metabolic regulator with pleiotropic effects.
Background
Human Fibroblast Growth Factor 21 (FGF21) acts in an endocrine mannerand and is a metabolic regulator with pleiotropic effects. FGF21 possesses protective effects in the cardiovascular system, primarily due to metabolic effects other thanmaintaining energy homoeostasis. FGF21 is also involved inseveral processes, including reducing arteriosclerotic plaque formation in major vessels and protecting themyocardium from injuries caused by infarction, ischaemia-reperfusion, isoproterenol-induced hypertrophy anddiabetic lipotoxicity. In addition, FG2F1 induces these effects by atten-uating remodelling-related inflammation and oxidativestress and promoting myocardial energy metabolism, as well as by preventing lipid- or diabetes-induced cardiaccell apoptosis. FGF21 functions via its interaction with FGF receptors (FGFRs), with the assistance of the co-receptor β-Klotho. Structurally, the FGFRs are divided into four isoforms, FGFR1-FGFR4[1].
Verified Bioactivity
Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is ≤5.179 μg/mL in the presence of 1 μg/mL Recombinant Human Klotho beta.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Human
-
Source CHO
-
Tag C-His
-
Accession
Q9NSA1 (H29-S209)
-
Molecular Construction
-
N-term
-
FGF-21 (H29-S209)
Accession # Q9NSA1 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FGF21; FGF-21; Fibroblast Growth Factor 21; FGF; Fibroblast Growth Factor
-
AA Sequence
HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
-
Predicted Molecular Mass
20.2 kDa
-
Molecular Weight
Approximately 23-25 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)