Copy Link Print Information

FGF-21 Protein, Mouse (HEK293, His)

3 Cited Publications
Customer Review

Based on 3 publication(s) in Google Scholar

FGF-21 Proteinas influences glucose uptake in adipocytes by inducing SLC2A1/GLUT1 expression, particularly with KLB's presence. It plays a crucial role in systemic glucose homeostasis and insulin sensitivity, interacting directly with KLB through its C-terminus and engaging with FGFR4. The protein's molecular mechanisms involve a complex interplay, emphasizing its broad impact beyond localized effects. FGF-21 Protein, Mouse (HEK293, His) is the recombinant mouse-derived FGF-21 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for FGF-21 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for FGF-21 Protein, Mouse (HEK293, His)
  • FGF-21 Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FGF-21 Proteinas influences glucose uptake in adipocytes by inducing SLC2A1/GLUT1 expression, particularly with KLB's presence. It plays a crucial role in systemic glucose homeostasis and insulin sensitivity, interacting directly with KLB through its C-terminus and engaging with FGFR4. The protein's molecular mechanisms involve a complex interplay, emphasizing its broad impact beyond localized effects. FGF-21 Protein, Mouse (HEK293, His) is the recombinant mouse-derived FGF-21 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

FGF-21 protein exerts its biological influence by promoting glucose uptake in differentiated adipocytes, primarily through inducing the expression of the glucose transporter SLC2A1/GLUT1, rather than SLC2A4/GLUT4. This activity is likely contingent on the presence of KLB. Beyond its localized effects, FGF-21 plays a crucial role in the regulation of systemic glucose homeostasis and insulin sensitivity. The protein interacts directly with KLB, facilitated by its C-terminus, and also engages with FGFR4, indicating a complex interplay in its molecular mechanisms.

Verified Bioactivity

Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.1-1.5 μg/mL in the presence of 1.25 μg/mL Recombinant Human Klotho beta (HY-P77972).

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.9543 μg/mL in the presence of 1.25 μg/mL Recombinant HumanKlotho beta .corresponding to a specific activity is 1047.88units/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q9JJN1 (A29-S210)

  • Gene ID
    56636  [NCBI]
  • Molecular Construction
    • N-term
    • FGF-21 (A29-S210)
      Accession # Q9JJN1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    FGF21; FGF-21; Fibroblast Growth Factor 21; FGF; Fibroblast Growth Factor

  • AA Sequence

    AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS

  • Predicted Molecular Mass

    20.8 kDa

  • Molecular Weight

    Approximately 20-25 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, pH 9.0.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.9543 μg/mL in the presence of 1.25 μg/mL Recombinant HumanKlotho beta .corresponding to a specific activity is 1047.88units/mg.

  • FGF-21 Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for FGF-21 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for FGF-21 Protein, Mouse (HEK293, His)
  • FGF-21 Protein, Mouse (HEK293, His) Product Image