Copy Link Print Information

FGF-21 Protein, Human

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

FGF-21 Protein, Human is an atypical member of the fibroblast growth factor (FGF) subfamily, acts as a metabolic regulator with pleiotropic effects.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for FGF-21 Protein, Human
  • FGF-21 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FGF-21 Protein, Human is an atypical member of the fibroblast growth factor (FGF) subfamily, acts as a metabolic regulator with pleiotropic effects.

Background

Human Fibroblast Growth Factor 21 (FGF21) acts in an endocrine mannerand and is a metabolic regulator with pleiotropic effects. FGF21 possesses protective effects in the cardiovascular system, primarily due to metabolic effects other thanmaintaining energy homoeostasis. FGF21 is also involved inseveral processes, including reducing arteriosclerotic plaque formation in major vessels and protecting themyocardium from injuries caused by infarction, ischaemia-reperfusion, isoproterenol-induced hypertrophy anddiabetic lipotoxicity. In addition, FG2F1 induces these effects by atten-uating remodelling-related inflammation and oxidativestress and promoting myocardial energy metabolism, as well as by preventing lipid- or diabetes-induced cardiaccell apoptosis. FGF21 functions via its interaction with FGF receptors (FGFRs), with the assistance of the co-receptor β-Klotho. Structurally, the FGFRs are divided into four isoforms, FGFR1-FGFR4[1].

Verified Bioactivity

The ED50 is <0.5 μg/mL as measured by FGF-receptors transfected BaF3 cells, corresponding to a specific activity of > 2.0 × 103 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    Q9NSA1 (H29-S209, with an N-terminal Gly)

  • Gene ID
    26291  [NCBI]
  • Molecular Construction
    • N-term
    • Gly
    • FGF-21 (H29-S209)
      Accession # Q9NSA1
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    FGF21; FGF-21; Fibroblast Growth Factor 21; FGF; Fibroblast Growth Factor

  • AA Sequence

    GHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

  • Molecular Weight

    Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS.

Endotoxin Level

<1.0 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Cao F, et al. Fibroblast growth factor 21 attenuates calcification of vascular smooth muscle cells in vitro. J Pharm Pharmacol. 2017 Dec;69(12):1802-1816. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • FGF-21 Protein, Human Product Image
    1/16
  • Experimental Validation Results for FGF-21 Protein, Human
  • FGF-21 Protein, Human Product Image