1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. Fibroblast Growth Factor 21 (FGF-21)
  6. FGF-21 Protein, Cynomolgus (HEK293, His)

FGF-21 Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P72650
COA Handling Instructions

FGF-21 is a metabolic regulator and a potential anti-diabetic agent. FGF-21 regulates energy balance and glucose and lipid homeostasis through a heterodimeric receptor complex comprising FGFR1 and 尾-klotho. FGF-21 can also signal through FGFR2 and FGFR3. FGF-21 can be used for research of obesity, NASH, NAFLD, and type 2 diabetes mellitus. FGF-21 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived FGF-21 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of FGF-21 Protein, Cynomolgus (HEK293, His) is 181 a.a., with molecular weight of 19-24 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $165 In-stock
50 μg $460 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGF-21 is a metabolic regulator and a potential anti-diabetic agent. FGF-21 regulates energy balance and glucose and lipid homeostasis through a heterodimeric receptor complex comprising FGFR1 and 尾-klotho. FGF-21 can also signal through FGFR2 and FGFR3. FGF-21 can be used for research of obesity, NASH, NAFLD, and type 2 diabetes mellitus[1][2]. FGF-21 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived FGF-21 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of FGF-21 Protein, Cynomolgus (HEK293, His) is 181 a.a., with molecular weight of 19-24 kDa.

Background

FGF-21, a stress-inducible hormone, regulates energy balance and glucose and lipid homeostasis through a heterodimeric receptor complex comprising FGFR1 and β-klotho. When binding to the FGFR1-β-klotho complex, FGF-21 triggers autophosphorylationof FGFR1 and activation of the downstream MAPK signalling cascade, and leads to phosphorylation-dependent activation of ERK1/2. FGF-21 can also signal through FGFR2 and FGFR3[1].
In additon, FGF-21 stimulates the oxidation of fatty acids, the production of ketone bodies, and the inhibition of lipogenesis. FGF-21 decreases blood glucose and plasma insulin in ob/ob obese mice, and can be used for research of obesity, NASH, NAFLD, and type 2 diabetes mellitus[1][2].

Species

Cynomolgus

Source

HEK293

Tag

C-6*His

Accession

XM_005589811.2 (H29-S209)

Gene ID

102126624  [NCBI]

Molecular Construction
N-term
FGF-21 (H29-S209)
Accession # XM_005589811.2
6*His
C-term
Synonyms
FGF21; Fibroblast Growth Factor 21; FGF-21
AA Sequence

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAAHQSPESLLQLKALKPGVIQILGVKTSRFLCQKPDGALYGSLHFDPEACSFRELLLENGYNVYQSEAHGLPLHLPGNKSPHRDPASQGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQARSPSYAS

Molecular Weight

19-24 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FGF-21 Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-21 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P72650
Quantity:
MCE Japan Authorized Agent: