FGF-21 Protein, Cynomolgus (HEK293, His)

Customer Review

Based on 1 Customer Validation

FGF-21 is a metabolic regulator and a potential anti-diabetic agent. FGF-21 regulates energy balance and glucose and lipid homeostasis through a heterodimeric receptor complex comprising FGFR1 and 尾-klotho. FGF-21 can also signal through FGFR2 and FGFR3. FGF-21 can be used for research of obesity, NASH, NAFLD, and type 2 diabetes mellitus. FGF-21 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived FGF-21 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

FGF-21 is a metabolic regulator and a potential anti-diabetic agent. FGF-21 regulates energy balance and glucose and lipid homeostasis through a heterodimeric receptor complex comprising FGFR1 and 尾-klotho. FGF-21 can also signal through FGFR2 and FGFR3. FGF-21 can be used for research of obesity, NASH, NAFLD, and type 2 diabetes mellitus[1][2]. FGF-21 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived FGF-21 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

FGF-21, a stress-inducible hormone, regulates energy balance and glucose and lipid homeostasis through a heterodimeric receptor complex comprising FGFR1 and β-klotho. When binding to the FGFR1-β-klotho complex, FGF-21 triggers autophosphorylationof FGFR1 and activation of the downstream MAPK signalling cascade, and leads to phosphorylation-dependent activation of ERK1/2. FGF-21 can also signal through FGFR2 and FGFR3[1].
In additon, FGF-21 stimulates the oxidation of fatty acids, the production of ketone bodies, and the inhibition of lipogenesis. FGF-21 decreases blood glucose and plasma insulin in ob/ob obese mice, and can be used for research of obesity, NASH, NAFLD, and type 2 diabetes mellitus[1][2].

Verified Bioactivity

Measured in a cell proliferation assay using NIH 3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.5175 μg/mL in the presence of 1.25 μg/mL Recombinant Human Klotho beta, corresponding to a specific activity is 1.932×103 units/mg.

MCE Validation Data

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using NIH 3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.5175 μg/mL in the presence of 1.25 μg/mL Recombinant Human Klotho beta, corresponding to a specific activity is 1.932×103 units/mg.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • FGF-21 (H29-S209)
      Accession # A0A2K5UYN8/XP_005589868.1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    FGF21; FGF-21; Fibroblast Growth Factor 21; FGF; Fibroblast Growth Factor

  • AA Sequence

    HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAAHQSPESLLQLKALKPGVIQILGVKTSRFLCQKPDGALYGSLHFDPEACSFRELLLENGYNVYQSEAHGLPLHLPGNKSPHRDPASQGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQARSPSYAS

  • Predicted Molecular Mass

    20.2 kDa

  • Molecular Weight

    Approximately 19-24 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00