KGF/FGF-7 Protein, Mouse (Tag free)

FGF-7 Protein, Mouse (His) is a potent mitogen that enhances cell proliferation in various organs, including the skin, intestine, breast, liver, and lung.

Fibroblast growth factor-7 (FGF-7) is a potent mitogen that enhances cell proliferation in various organs, including the skin, intestine, breast, liver, and lung^[1]. FGF-7, also known as keratinocyte growth factor, insofar as it displays a unique cell specificity. FGF7 binds to perlecan protein core and that exogenous perlecan efficiently reconstitutes FGF7 mitogenic activity in perlecan-deficient cells^[2].

The ED₅₀ is ≤10 ng/mL as measured by 4MBr-5 cells, corresponding to a specific activity of ≥1 × 10⁵ units/mg.

Mouse

E. coli

Tag Free

P36363 (C32-T194)

14178  [NCBI]

CNDMSPEQTATSVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNSYNIMEIRTVAVGIVAIKGVESEYYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGIPVKGKKTKKEQKTAHFLPMAIT

Approximately 18.7 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Tichelaar JW, et al. Conditional expression of fibroblast growth factor-7 in the developing and mature lung. J Biol Chem. 2000 Apr 21;275(16):11858-64.  [Content Brief]

  [2]. Mongiat M, et al. The protein core of the proteoglycan perlecan binds specifically to fibroblast growth factor-7. J Biol Chem. 2000 Mar 10;275(10):7095-100.