1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily
  4. Activin/Inhibins Receptor
  5. Follistatin
  6. Follistatin/FST Protein, Human (HEK293, His)

Follistatin (FST) is a regulator of TGFβ family signaling and acts by selectively binding to TGFβ family ligands and preventing ligand binding to the receptor complex. Follistatin has the ability to suppress the follicle stimulating hormone (FSH). Follistatin/FST Protein, Human (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 288 amino acids (G30-N317).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Follistatin/FST Protein, Human (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Follistatin (FST) is a regulator of TGFβ family signaling and acts by selectively binding to TGFβ family ligands and preventing ligand binding to the receptor complex. Follistatin has the ability to suppress the follicle stimulating hormone (FSH)[1][2]. Follistatin/FST Protein, Human (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 288 amino acids (G30-N317).

Background

Follistatin is first described as a follicle-stimulating hormone inhibiting substance present in ovarian follicular fluid. Follistatin binds activin A and myostatin with low nanomolar (nM) affinity, completely surrounds the ligand occluding all of the receptor binding sites and binds to the ligand[1][2].
Mature human Follistatin shares 97% amino acid sequence identity with mouse and rat Follistatin.
Follistatin is a 32-35-kDa glycoprotein composed of four domains including an N-terminal domain (ND) followed by three Follistatin domains (FSD1, FSD2, and FSD3). C-terminal splicing of Follistatin can occur to generate various isoforms including FS288 and FS315. Follistatin neutralizes the TGFβ ligands, myostatin and activin A, by forming a nearly irreversible non-signaling complex by surrounding the ligand and preventing interaction with TGFβ receptors. In humans, the gene encoding Follistatin is located on chromosome 5q11.2. The Follistatin protein contains a TGF-β binding site where activins, bone morphonegic proteins (BMPs) and growth differentiation factors (GDFs) are bound with high affinity and thereby neutralised. The ligand binding site for Follistatin overlaps with the type I and type II receptor binding sites for these ligands. Follistatin also contains a heparin binding site where proteoglycans in the extracellular matrix can bind, and therefore Follistatin is believed to bind the extracellular matrix. There are two major isoforms of Follistatin, FST288, which is anchored to the cell surface by interactions with heparin sulfate proteoglycans, and FST315, which is the predominant form found in circulation. The two isoforms arise from alternative splicing; the 315 isoform includes a 27 amino acid acidic C-terminal tail, which Follistatin 288 does not have. The acidic tail on Follistatin 315 neutralises the heparin binding site, thereby inhibiting the binding of Follistatin 315 to the extracellular matrix[1][2][3].
Follistatin as a liver-derived protein under the regulation of glucagon-to-insulin ratio suggests a relation to energy metabolism. In humans, aberrant expression of FST and activins are implicated in infertility. Follistatin is a potent tissue regulator in the gonad, pituitary gland, pregnancy membranes, vasculature, and liver[1][3].

In Vitro

Recombinant human Follistatin (500 ng/mL; for 72 h) blocks activin A-stimulated cell proliferation in KGN cells[4].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P19883-2 (G30-N317)

Gene ID
Molecular Construction
N-term
Follistatin/FST (G30-N317)
Accession # P19883-2
6*His
C-term
Protein Length

Partial

Synonyms
follistatin isoform FS288; FS-288; Follistatin; FS; FSActivin-binding protein; FST
AA Sequence

GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN

Predicted Molecular Mass
32.4 kDa
Molecular Weight

Approximately 33-42 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Follistatin/FST Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Follistatin/FST Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Follistatin/FST Protein, Human (HEK293, His)
Cat. No.:
HY-P70315
Quantity:
MCE Japan Authorized Agent: