GDNF Protein, Rat (sf9, His)
Based on 1 Customer Validation
Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs)., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons. GDNF Protein, Rat (sf9, His) is produced in Sf9 insect cells with a N-Terminal His-tag. It consists of 134 amino acids (S78-I211).
- Species: Rat
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs)., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons[1]. GDNF Protein, Rat (sf9, His) is produced in Sf9 insect cells with a N-Terminal His-tag. It consists of 134 amino acids (S78-I211).
Background
Glial cell line-derived neurotrophic factor (GDNF) is a 134 amino acid protein belonging in the GDNF family ligands (GFLs). GDNF protein is widely distributed throughout both the central and peripheral nervous systems. Synthesis and secretion of GDNF occur in many cell types such as glial cells like astrocytes, oligodendrocytes, and Schwann cells; motor neurons (MNs); and skeletal muscle[1].
Mature human GDNF shares 91-92% amino acid sequence identity with mouse, rat, and Canine GDNF proteins. While, mouse GDNF shares 99% aa sequence identity with rat GDNF protein.
GDNF is originally isolated from cultured B49 rat glial cells and found to enhance the survival and differentiation of dopaminergic neurons in primary cultures by promoting dopamine uptake. Similar to other members of the TGF-β superfamily, GDNF is first synthesized as a precursor protein (pro-GDNF). After a series of protein cleavage and processing, the 211 amino acid pro-GDNF is finally converted into the active and mature form of GDNF. GDNF has the ability to trigger receptor tyrosine kinase RET phosphorylation, whose downstream effects have been found to promote neuronal health and survival. The binding of GDNF to its receptors triggers several intracellular signaling pathways which play roles in promoting the development, survival, and maintenance of neuron-neuron and neuron-target tissue interactions. The synthesis and regulation of GDNF have been shown to be altered in many diseases, aging, exercise, and addiction. The neuroprotective effects of GDNF may be used to develop treatments and therapies to ameliorate neurodegenerative diseases such as amyotrophic lateral sclerosis (ALS)[1].
GDNF is a potent neurotrophic factor for regulating MN survival in the peripheral nervous system. GDNF prevents apoptosis of MNs during development in vivo, decreases the loss of MNs in animal models of motor neuropathy and degeneration, rescues MNs from axotomy-induced cell death, and protects MNs from chronic degeneration. Intracerebral GDNF administration exerts both protective and reparative effects on the nigrostriatal dopamine system, which may have implications for the development of new treatment strategies for Parkinson's disease[1][2].
In Vitro
Recombinant rat GDNF (5 ng/mL) promotes neurite outgrowth from cultured adult rat dorsal root ganglia (DRG) neurons, and significantly increases the number of IB4-binding neurons and the relative protein expression of galectin-1 in the neuron-enriched culture of DRG[3].
In Vivo
Recombinant human GDNF (15 and 3 μg; two doses) into the rat striatum (total volume of 1 μL for 2 min; the infusion rate was .5 μl/min) by convection-enhanced delivery (CED). GDNF results in a sharp increase in striatal GDNF levels followed by a rapid decrease between day 3 and 7. Dopamine (DA) turnover is significantly increased in a dose-dependent manner for more than 7 days after a single GDNF infusion[4].
Verified Bioactivity
1.Measured in a cell proliferation assay using SH-SY5Y human neuroblastoma cells. The ED50 is typically ≤50 ng/mL in the presence of Rat GFR alpha-1/GDNF R alpha-1 His Chimera.
2. Immobilized GDNF Protein, Rat (sf9, His) at 10 μg/mL (100 μl/well) can bind rat GFRA1-Fc and the EC50 is 20-46.6 ng/mL.
Technical Parameters
-
Species Rat
-
Source Sf9 insect cells
-
Tag N-6*His
-
Accession
Q07731-1 (S78-I211)
-
Molecular Construction
-
N-term
-
6*His
-
GDNF (S78-I211)
Accession # Q07731-1 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
GDNF; ATF2; Glial Cell Derived Neurotrophic Factor; ATF; Astrocyte-Derived Trophic Factor; Glial Cell Line Derived Neurotrophic Factor; Glial Cell Line-Derived Neurotrophic Factor; Glial Derived Neurotrophic Factor; HFB1-GDNF; HSCR3; ATF1; HGDNF
-
AA Sequence
SPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCEAAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDSLVYHILRKHSAKRCGCI
-
Predicted Molecular Mass
17.1 kDa
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.5, 10% glycerol.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Alberto F Cintrón-Colón, et al. GDNF synthesis, signaling, and retrograde transport in motor neurons. Cell Tissue Res. 2020 Oct;382(1):47-56. [Content Brief]
[2]. Tomac A, et al. Protection and repair of the nigrostriatal dopaminergic system by GDNF in vivo. Nature.1995;373 (6512): 335-339. [Content Brief]
[3]. Shizuka Takaku, et al. GDNF promotes neurite outgrowth and upregulates galectin-1 through the RET/PI3K signaling in cultured adult rat dorsal root ganglion neurons. Neurochem Int. 2013 Feb;62(3):330-9. [Content Brief]
[4]. Piotr Hadaczek, et al. Pharmacokinetics and bioactivity of glial cell line-derived factor (GDNF) and neurturin (NTN) infused into the rat brain. Neuropharmacology. 2010 Jun;58(7):1114-21. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)