1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily Neurotrophic Factors
  4. GDNF family
  5. GFR-alpha-1
  6. GFRAL Protein, Mouse (HEK293, His-Myc)

GFRAL Protein, Mouse (HEK293, His-Myc)

Cat. No.: HY-P700449
Handling Instructions

GFRAL protein, a brainstem-restricted receptor, regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. It binds with GDF15, interacts with RET, and activates MAPK- and AKT- signaling pathways. GFRAL acts as a receptor for GDF15 and mediates cellular signaling through RET, requiring prior GDF15 binding. GFRAL Protein, Mouse (HEK293, His-Myc) is the recombinant mouse-derived GFRAL protein, expressed by HEK293, with C-Myc, N-10*His labeled tag. The total length of GFRAL Protein, Mouse (HEK293, His-Myc) is 330 a.a., with molecular weight of 42.1 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GFRAL protein, a brainstem-restricted receptor, regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. It binds with GDF15, interacts with RET, and activates MAPK- and AKT- signaling pathways. GFRAL acts as a receptor for GDF15 and mediates cellular signaling through RET, requiring prior GDF15 binding. GFRAL Protein, Mouse (HEK293, His-Myc) is the recombinant mouse-derived GFRAL protein, expressed by HEK293, with C-Myc, N-10*His labeled tag. The total length of GFRAL Protein, Mouse (HEK293, His-Myc) is 330 a.a., with molecular weight of 42.1 kDa.

Background

GFRAL protein is a brainstem-restricted receptor that plays a crucial role in regulating food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. Upon binding with its ligand, GDF15, GFRAL interacts with RET and activates MAPK- and AKT- signaling pathways. GFRAL interacts with GDF15 and RET through its extracellular domain, acting as a receptor for GDF15 and mediating cellular signaling through the interaction with RET after GDF15 binding. It is important to note that the interaction with RET requires previous GDF15 binding.

Species

Mouse

Source

HEK293

Tag

C-Myc;N-10*His

Accession

Q6SJE0 (Q20-G349)

Gene ID

404194  [NCBI]

Molecular Construction
N-term
10*His-Myc
GFRAL (Q20-G349)
Accession # Q6SJE0
C-term
Synonyms
GFR alpha-like; GFRAL; GRAL; C6orf144
AA Sequence

QTNDCAHLIQKCLIDANGCEQSWRSMEDTCLTPGDSCKINNSLHCNLSIQALVEKNFQFKECLCMDDLHCTVNKLFGKKCTNKTDNMEKDNKDKWNLTTTPFYHGFKQMQSCLEVTEACVGDVVCNAQLALYLKACSANGNLCDVKHCQAAIRFFYQNMPFNTAQMLAFCDCAQSDIPCQQSKETLHSKPCALNIVPPPTCLSVIHTCRNDELCRTHYRTFQTECWPHITGKCHEDETCISMLGKQDLTCSGSESCRAAFLGTFGTVLQVPCACRGVTQAEEHVCMIFQHMLHSKSCFNYPTPNVKDISSYEKKNSKEITLTGFNSFFNG

Molecular Weight

42.1 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GFRAL Protein, Mouse (HEK293, His-Myc)
Cat. No.:
HY-P700449
Quantity:
MCE Japan Authorized Agent: