1. Recombinant Proteins
  2. Others
  3. GLIPR1 Protein, Human (HEK293, His)

GLIPR1 Protein, Human (HEK293, His)

Cat. No.: HY-P70359
Handling Instructions

GLIPR1 Protein is a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. It may function as a tumor inducer or a tumor suppressor. GLIPR1 promotes cell survival, growth, chemoresistance, and metastasis of glioma by multiple mechanisms, including the activation of STAT3 and CXCR4 signaling. GLIPR1 Protein, Human (HEK293, His) is the recombinant human-derived GLIPR1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of GLIPR1 Protein, Human (HEK293, His) is 211 a.a., with molecular weight of ~29.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GLIPR1 Protein is a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. It may function as a tumor inducer or a tumor suppressor. GLIPR1 promotes cell survival, growth, chemoresistance, and metastasis of glioma by multiple mechanisms, including the activation of STAT3 and CXCR4 signaling. GLIPR1 Protein, Human (HEK293, His) is the recombinant human-derived GLIPR1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of GLIPR1 Protein, Human (HEK293, His) is 211 a.a., with molecular weight of ~29.0 kDa.

Background

Glioma pathogenesis-related protein 1 (GLIPR1) is a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. GLIPR1 is initially identified in glioblastoma. GLIPR1 promotes proliferation, metastasis and 5-fluorouracil resistance in hepatocellular carcinoma by activating the PI3K/PDK1/ROCK1 pathway. GLIPR1 promotes cell survival, growth, chemoresistance, and metastasis of glioma by multiple mechanisms. GLIPR1 can also mediate the role of signal transducer and activator of transcription 3 (STAT3) in regulating the glioma epithelial-mesenchymal transition by increasing the expression of IL-6 which in turn activates STAT3 pathway. GLIPR1 has been found functioning as a tumor suppressor in prostate cancer, lung cancer, bladder cancer, and osteosarcoma via inducing cell cycle arrest, apoptosis, inhibiting key oncogenic drivers including c-Myc and TPX2, as well as triggering other tumor suppressors such as p53[1][2][3][4].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P48060 (A22-R232)

Gene ID
Molecular Construction
N-term
GLIPR1 (A22-R232)
Accession # P48060
6*His
C-term
Synonyms
rHuGlioma pathogenesis-related protein 1/GliPR1, His; Glioma Pathogenesis-Related Protein 1; GliPR 1; Protein RTVP-1; GLIPR1; GLIPR; RTVP1
AA Sequence

ANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDKCLDNLCVNRQRDQVKRYYSVVYPGWPIYPRNR

Molecular Weight

Approximately 29.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

GLIPR1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GLIPR1 Protein, Human (HEK293, His)
Cat. No.:
HY-P70359
Quantity:
MCE Japan Authorized Agent: