HSP40/DNAJB1 Protein, Human (His)

HSP40/DNAJB1 protein, a key player in cellular processes, interacts with HSP70 to enhance ATPase activity and stimulate HSC70-HIP association. It negatively regulates HSF1 transcriptional activity in heat shock response recovery, and interacts with DNAJC3 and HSF1, inhibiting their transcriptional activity. These multifaceted interactions showcase HSP40/DNAJB1's intricate regulatory functions in stress responses and protein folding. HSP40/DNAJB1 Protein, Human (His) is the recombinant human-derived HSP40/DNAJB1 protein, expressed by E. coli , with C-6*His labeled tag. The total length of HSP40/DNAJB1 Protein, Human (His) is 339 a.a., with molecular weight of ~38.0 kDa.

The HSP40/DNAJB1 protein plays a crucial role in cellular processes through its interactions with various partners. It interacts with HSP70, enhancing its ATPase activity and stimulating the association between HSC70 and HIP. Moreover, HSP40/DNAJB1 negatively regulates the transcriptional activity of HSF1 during the attenuation and recovery phase of the heat shock response, demonstrating its role in modulating heat shock-induced processes. Additionally, HSP40/DNAJB1 interacts with DNAJC3 and HSF1, inhibiting their transcriptional activity during the recovery phase of the heat shock response. These interactions highlight the multifaceted nature of HSP40/DNAJB1 in orchestrating cellular responses to stress and protein folding, shedding light on its intricate regulatory functions.

Human

E. coli

C-6*His

P25685 (G2-I340)

3337  [NCBI]

GKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI

Approximately 38.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of PBS, 1 mM EDTA, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.