Copy Link Print Information

HSP40/DNAJB1 Protein, Human (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

HSP40/DNAJB1 protein, a key player in cellular processes, interacts with HSP70 to enhance ATPase activity and stimulate HSC70-HIP association. It negatively regulates HSF1 transcriptional activity in heat shock response recovery, and interacts with DNAJC3 and HSF1, inhibiting their transcriptional activity. These multifaceted interactions showcase HSP40/DNAJB1's intricate regulatory functions in stress responses and protein folding. HSP40/DNAJB1 Protein, Human (His) is the recombinant human-derived HSP40/DNAJB1 protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • HSP40/DNAJB1 Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

HSP40/DNAJB1 protein, a key player in cellular processes, interacts with HSP70 to enhance ATPase activity and stimulate HSC70-HIP association. It negatively regulates HSF1 transcriptional activity in heat shock response recovery, and interacts with DNAJC3 and HSF1, inhibiting their transcriptional activity. These multifaceted interactions showcase HSP40/DNAJB1's intricate regulatory functions in stress responses and protein folding. HSP40/DNAJB1 Protein, Human (His) is the recombinant human-derived HSP40/DNAJB1 protein, expressed by E. coli , with C-6*His labeled tag.

Background

The HSP40/DNAJB1 protein plays a crucial role in cellular processes through its interactions with various partners. It interacts with HSP70, enhancing its ATPase activity and stimulating the association between HSC70 and HIP. Moreover, HSP40/DNAJB1 negatively regulates the transcriptional activity of HSF1 during the attenuation and recovery phase of the heat shock response, demonstrating its role in modulating heat shock-induced processes. Additionally, HSP40/DNAJB1 interacts with DNAJC3 and HSF1, inhibiting their transcriptional activity during the recovery phase of the heat shock response. These interactions highlight the multifaceted nature of HSP40/DNAJB1 in orchestrating cellular responses to stress and protein folding, shedding light on its intricate regulatory functions.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession

    P25685-1 (G2-I340)

  • Gene ID
    3337  [NCBI]
  • Molecular Construction
    • N-term
    • HSP40 (G2-I340)
      Accession # P25685-1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    DNAJB1; CDNA, FLJ93008, Homo Sapiens DnaJ (Hsp40) Homolog, Subfamily B, Member 1 (DNAJB1),MRNA; Prev. HSPF1; Radial Spoke 16 Homolog B (Chlamydomonas); DnaJ Homolog Subfamily B Member 1; Radial Spoke 16 Homolog B; RSPH16B; Heat Shock Protein 40; Hsp40; DN

  • AA Sequence

    GKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI

  • Predicted Molecular Mass

    39.1 kDa

  • Molecular Weight

    Approximately 38 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 1 mM EDTA, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • HSP40/DNAJB1 Protein, Human (His) Product Image
    1/16
  • HSP40/DNAJB1 Protein, Human (His) Product Image