1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. CCL1
  6. I-309/CCL1 Protein, Mouse (HEK293, Fc)

I-309/CCL1 Protein, Mouse (HEK293, Fc) is a cytokine that mediates inflammatory immune responses, viral infections, and tumorigenesis by interacting with the CCR8 chemokine receptor on the cell surface and attracting monocytes, natural killer cells, and immature B-cell nuclear dendritic cells. I-309/CCL1 Protein, Mouse (HEK293, Fc) is a recombinant mouse CCL1 (K24-C92) expressed by HEK293 with a -hFc tag at the nitrogen end.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

2 Publications Citing Use of MCE I-309/CCL1 Protein, Mouse (HEK293, Fc)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

I-309/CCL1 Protein, Mouse (HEK293, Fc) is a cytokine that mediates inflammatory immune responses, viral infections, and tumorigenesis by interacting with the CCR8 chemokine receptor on the cell surface and attracting monocytes, natural killer cells, and immature B-cell nuclear dendritic cells. I-309/CCL1 Protein, Mouse (HEK293, Fc) is a recombinant mouse CCL1 (K24-C92) expressed by HEK293 with a -hFc tag at the nitrogen end[1].

Background

CCL1 is a small glycoprotein belonging to the CC chemokine family with a molecular weight of approximately 15-16 kDa, known as small inducible cytokine I-309 in humans and TCA-3 in mice. CCL1 is secreted by activated monocytes, macrophages, T lymphocytes and endothelial cells and is chemotactic for monocytes but not for neutrophils[1].    CCL1 can be activated by interaction with the cell surface chemokine receptor CCR8, which induces Ca2+ influx, stimulates transient increases in cytoplasmic free calcium concentration in monocytes, and inhibits apoptosis in thymocyte lines via the RAS/MAPK pathway. Among others, CCR8 is constitutively expressed in monocytes, macrophages, Th2 and regulatory T lymphocytes and is the sole receptor for the human CCL1 and for the viral chemokine, vCCL1 (viral macrophage inflammatory protein 1). CCR8 has been shown to be associated with phagocytic macrophages and activated microglia in MS lesions and is directly related to demyelinating activity[2].     CCL1 is involved in inflammatory processes through leukocyte recruitment and can play a key role in angiogenesis and other viral and neoplastic processes. A number of single nucleotide polymorphisms (SNPs) in the CCL1 gene have been associated with the progression of chronic obstructive pulmonary disease (COPD). In parallel, CCL1 plays a role in various CNS functions and diseases and may be associated with neuroinflammatory disorders[3].

In Vivo

CCL1 (instill, in 5 μL of LPS-free PBS (5 μg/kg), every 3 days for one month ) can induce pulmonary fibrotic changes, decrease lung function and increase collagen deposition in C57BL/6J mice by exogenous addition. Besides, CCL1 activates fibroblasts in the lung through CCR8 recruitment and induces migration of lung fibroblasts[4].
  CCL1 (s.c., 1-1 µg/kg) produces a dose-dependent and long-lasting increase in thermal withdrawal latency, noxious thermal stimulation is observed at 1 µg/kg and a decrease in spinal cord neurons expressing Fos protein, further indicating its analgesic properties in male Swiss mice[5].

Biological Activity

Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with mouse CCR8. The ED50 for this effect is <2.0 ng/mL.

  • Measured by its ability to chemoattract BaF3 mouse pro‑B cells transfected with mouse CCR8. The ED50 for this effect is 1.306 ng/mL, corresponding to a specific activity is 7.657×10^5 U/mg.
Species

Mouse

Source

HEK293

Tag

N-hFc

Accession

P10146-1 (K24-C92)

Gene ID
Molecular Construction
N-term
hFc
CCL1 (K24-C92)
Accession # P10146-1
C-term
Protein Length

Full Length of Isoform 1 Mature Protein

Synonyms
C-C motif chemokine 1; CCL1; SCYA1; TCA-3
AA Sequence

KSMLTVSNSCCLNTLKKELPLKFIQCYRKMGSSCPDPPAVVFRLNKGRESCASTNKTWVQNHLKKVNPC

Molecular Weight

Approximately 40-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

I-309/CCL1 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

I-309/CCL1 Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
I-309/CCL1 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P73913
Quantity:
MCE Japan Authorized Agent: