IFN-alpha 2a/IFNA2 Protein, Human (R46K)

IFN-alpha 2 (IFNA2), belongs to type I interferon family, is a protein secreted by cells infected by a virus and acting on other cells to inhibit viral infection^[1]. IFN-alpha 2 increases the frequencies of cytotoxic CD8⁺ T cells and induces CD4⁺ T cell depletion^[3]. IFN-alpha 2a/IFNA2 Protein, Human (C24-E188, R46K) contains 165 a.a., is produced in E. coli with tag free.

IFN-alpha 2 (IFNA2; IFN-α2), belongs to the type I interferon family, produced by the plasmacytoid dendritic cells (pDCs) exposure to HIV-1BaL in order to inhibit viral infection^[1].
Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively^[2].
IFN-alpha 2 subtype is the only one that is currently licensed to treat infections caused by hepatitis B virus (HBV) and HCV^[3].
IFN-alpha 2 shows a Sortilin-dependent trafficking in cells and increases the expression level of interferon-stimulated genes (ISGs) in HIV-infected cells^[1][4]. It also exhibits cytotoxic activity against CD8⁺ T cells and enhances CD4⁺ T cell depletion^[3].
Among the IFN-alpha 2 alleles, IFN-alpha 2b is being the predominant allele while IFNα-2a is less predominant and IFNα-2c only a minor allelic variant^[5].
IFN-alpha 2 has a bored application in research of cancer, including some hematological malignancies and solid tumors^[6]. As for a wildly use of IFN in animal disease model, the sequence of amino acids in IFNA2a protein of human is very different from mouse (59.57%).

IFNA2a (hydrodynamic injection with plasmids) leads to upregulation of interferon-stimulated genes (ISGs) and results HIV-1 induced CD4+ T cell depletion in the hu-PBL humanized mouse model^[3].

The ED₅₀ is ≤0.5005 ng/mL as measured by TF-1 cells, corresponding to a specific activity of ≥1.998 × 10⁶ units/mg.

• 
  Measured by a cytotoxicity assay using TF-1 Cells. The ED₅₀ for this effect is 0.1509 ng/mL, corresponding to a specific activity is 6.627 ×10⁶units/mg.

Human

E. coli

Tag Free

P01563 (C24-E188, R46K)

3440  [NCBI]

Full Length of Mature Protein

CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.
2.Lyophilized from a 0.22 μm filtered solution of PBS.
3.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/pbmc-cell.html  [Content Brief]

  [2]. Abraham S, et al. Gene therapy with plasmids encoding IFN-β or IFN-α14 confers long-term resistance to HIV-1 in humanized mice. Oncotarget. 2016 Nov 29;7(48):78412-78420.  [Content Brief]

  [3]. Gerasymenko IM, et al. MULTIPLEX PCR ASSAY FOR DETECTION OF HUMAN SOMATOTROPIN AND INTERFERON ALPHA2b GENES IN PLANT MATERIAL. Tsitol Genet. 2015 May-Jun;49(3):3-8.  [Content Brief]

  [4]. Zhang SY, et al. Inborn errors of interferon (IFN)-mediated immunity in humans: insights into the respective roles of IFN-alpha/beta, IFN-gamma, and IFN-lambda in host defense. Immunol Rev. 2008 Dec;226:29-40.  [Content Brief]

  [5]. Chang CH, et al. A new method to produce monoPEGylated dimeric cytokines shown with human interferon-α2b. Bioconjug Chem. 2009 Oct 21;20(10):1899-907.  [Content Brief]

  [6]. Sutter K, et al. Interferon α subtypes in HIV infection. Cytokine Growth Factor Rev. 2018 Apr;40:13-18.  [Content Brief]

  [7]. Watanabe H, et al. Detailed structure of mouse interferon α2 and its interaction with Sortilin. J Biochem. 2021 Oct 11;170(2):265-273.  [Content Brief]

  [8]. Gull I, et al. Heterologous expression, immunochemical and computational analysis of recombinant human interferon alpha 2b. Springerplus. 2013 Jun 15;2(1):264.  [Content Brief]

  [9]. Paul F, et al. IFNA2: The prototypic human alpha interferon. Gene. 2015 Aug 10;567(2):132-7.  [Content Brief]