IFN-gamma Protein, Cynomolgus (HEK293, His)

IFN-gamma (interferon-gamma) is a type II interferon derived from immune cells such as T cells and NK cells, which can significantly activate effector immune cells and enhance antigen presentation. It affects gene regulation through the JAK-STAT pathway and its receptor IFNGR1. IFN-gamma Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IFN-gamma protein, expressed by HEK293 , with C-His labeled tag.

IFN-gamma (Interferon-gamma), a type II interferon produced by immune cells like T-cells and NK cells, plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation. Its primary signaling pathway involves the JAK-STAT pathway after interaction with its receptor, IFNGR1, affecting gene regulation. Upon IFN-gamma binding, the IFNGR1 intracellular domain opens out, allowing the association of downstream signaling components JAK2, JAK1, and STAT1, resulting in STAT1 activation, nuclear translocation, and transcription of IFN-gamma-regulated genes. Many of these induced genes are transcription factors such as IRF1, capable of further driving the regulation of a subsequent wave of transcription. IFN-gamma contributes to the class I antigen presentation pathway by inducing a replacement of catalytic proteasome subunits with immunoproteasome subunits, thereby increasing the quantity, quality, and repertoire of peptides for class I MHC loading. It also enhances the efficiency of peptide generation by inducing the expression of the activator PA28, which associates with the proteasome and alters its proteolytic cleavage preference. Additionally, IFN-gamma up-regulates MHC II complexes on the cell surface by promoting the expression of key molecules such as cathepsins B/CTSB, H/CTSH, and L/CTSL. Beyond its direct immune functions, IFN-gamma participates in the regulation of hematopoietic stem cells during development and under homeostatic conditions, influencing their development, quiescence, and differentiation. Existing as a homodimer, IFN-gamma interacts with IFNGR1 via its extracellular domain; this interaction is pivotal in promoting IFNGR1 dimerization and orchestrating the diverse and critical functions of IFN-gamma in immune responses and hematopoiesis.

Immobilized Cynomolgus IFN gamma, His Tag at 0.5 μg/mL (100 μL/well) on the plate. Dose response curve for Human IFNGR1, hFc Tag with the EC₅₀ of 39.4 ng/mL determined by ELISA.

Cynomolgus

HEK293

C-8*His

P63309 (Q24-Q165)

102128291  [NCBI]

Full Length of Mature Protein

QDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKEESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTNYSVTDSNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ

25-35 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.