1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-γ
  5. IFN-gamma Protein, Rat (HEK293, Fc)

IFN-gamma (interferon-gamma) is a type II interferon produced by T cells and NK cells, which can significantly activate antibacterial, antiviral and antitumor responses.It acts through the JAK-STAT pathway and its receptor IFNGR1 to affect gene regulation.IFN-gamma Protein, Rat (HEK293, Fc) is the recombinant rat-derived IFN-gamma protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IFN-gamma (interferon-gamma) is a type II interferon produced by T cells and NK cells, which can significantly activate antibacterial, antiviral and antitumor responses.It acts through the JAK-STAT pathway and its receptor IFNGR1 to affect gene regulation.IFN-gamma Protein, Rat (HEK293, Fc) is the recombinant rat-derived IFN-gamma protein, expressed by HEK293 , with C-hFc labeled tag.

Background

IFN-gamma (Interferon-gamma), a type II interferon produced by immune cells like T-cells and NK cells, assumes crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation. Its primary signaling occurs through the JAK-STAT pathway upon interaction with its receptor, IFNGR1, influencing gene regulation. Upon IFN-gamma binding, the IFNGR1 intracellular domain opens out, facilitating the association of downstream signaling components, including JAK2, JAK1, and STAT1, leading to STAT1 activation, nuclear translocation, and transcription of IFNG-regulated genes. Many of the induced genes are transcription factors, such as IRF1, capable of further driving the regulation of a subsequent wave of transcription. IFN-gamma also plays a role in the class I antigen presentation pathway by inducing the replacement of catalytic proteasome subunits with immunoproteasome subunits, thereby increasing the quantity, quality, and repertoire of peptides for class I MHC loading. It enhances the efficiency of peptide generation by inducing the expression of the activator PA28, which associates with the proteasome and alters its proteolytic cleavage preference. Additionally, IFN-gamma up-regulates MHC II complexes on the cell surface by promoting the expression of key molecules such as cathepsins B/CTSB, H/CTSH, and L/CTSL. Beyond its immune functions, IFN-gamma participates in the regulation of hematopoietic stem cells during development and under homeostatic conditions, influencing their development, quiescence, and differentiation. Existing as a homodimer, IFN-gamma interacts with IFNGR1 via its extracellular domain, a crucial interaction that promotes IFNGR1 dimerization to orchestrate its diverse and critical functions in immune responses and hematopoiesis.

Species

Rat

Source

HEK293

Tag

C-hFc

Accession

P01581 (Q23-C156)

Gene ID
Molecular Construction
N-term
IFN-gamma (Q23-C156)
Accession # P01581
hFc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
IFG; IFI; IFNG; IFN-gamma; Immune interferon; Interferon gamma
AA Sequence

QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC

Predicted Molecular Mass
42.5 kDa
Molecular Weight

Approximately 52 kDa,based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

IFN-gamma Protein, Rat (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IFN-gamma Protein, Rat (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-gamma Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P73254
Quantity:
MCE Japan Authorized Agent: