1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-γ
  5. IFN-gamma Protein, Sheep (His)

IFN-gamma Protein, Sheep (His)

Cat. No.: HY-P72245
COA Handling Instructions

IFN-gamma (interferon-gamma) is a type II interferon produced by T cells and NK cells, which can significantly activate antibacterial, antiviral and antitumor responses. It acts through the JAK-STAT pathway and its receptor IFNGR1 to affect gene regulation. IFN-gamma Protein, Sheep (His) is the recombinant sheep-derived IFN-gamma protein, expressed by E. coli , with N-6*His labeled tag. The total length of IFN-gamma Protein, Sheep (His) is 143 a.a., with molecular weight of ~21 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
20 μg $280 In-stock
50 μg $600 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IFN-gamma (interferon-gamma) is a type II interferon produced by T cells and NK cells, which can significantly activate antibacterial, antiviral and antitumor responses. It acts through the JAK-STAT pathway and its receptor IFNGR1 to affect gene regulation. IFN-gamma Protein, Sheep (His) is the recombinant sheep-derived IFN-gamma protein, expressed by E. coli , with N-6*His labeled tag. The total length of IFN-gamma Protein, Sheep (His) is 143 a.a., with molecular weight of ~21 kDa.

Background

IFN-gamma (Interferon-gamma), a type II interferon produced by immune cells like T-cells and NK cells, assumes pivotal roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation. Its primary signaling occurs through the JAK-STAT pathway upon interaction with its receptor, IFNGR1, influencing gene regulation. Upon IFN-gamma binding, the IFNGR1 intracellular domain unfolds, facilitating the association of downstream signaling components, including JAK2, JAK1, and STAT1. This sequence leads to STAT1 activation, nuclear translocation, and the transcription of IFN-gamma-regulated genes, many of which encode transcription factors like IRF1, capable of further driving the regulation of subsequent transcriptional events. IFN-gamma also contributes to the class I antigen presentation pathway by inducing the replacement of catalytic proteasome subunits with immunoproteasome subunits, thereby increasing the quantity, quality, and repertoire of peptides for class I MHC loading. Additionally, it enhances the efficiency of peptide generation by inducing the expression of the activator PA28, which associates with the proteasome and alters its proteolytic cleavage preference. Furthermore, IFN-gamma up-regulates MHC II complexes on the cell surface by promoting the expression of key molecules such as cathepsins B/CTSB, H/CTSH, and L/CTSL. Beyond its immune functions, IFN-gamma participates in the regulation of hematopoietic stem cells during development and under homeostatic conditions, influencing their development, quiescence, and differentiation. Existing as a homodimer, IFN-gamma interacts with IFNGR1 via its extracellular domain, a crucial interaction that promotes IFNGR1 dimerization to orchestrate its diverse and critical functions in immune responses and hematopoiesis.

Species

Sheep

Source

E. coli

Tag

N-6*His

Accession

P17773 (Q24-M166)

Gene ID

443396  [NCBI]

Molecular Construction
N-term
6*His
IFN-gamma (Q24-M166)
Accession # P17773
C-term
Synonyms
IFNG; Interferon gamma; IFN-gamma
AA Sequence

QGPFFKEIENLKEYFNASNPDVAKGGPLFSEILKNWKEESDKKIIQSQIVSFYFKLFENLKDNQVIQRSMDIIKQDMFQKFLNGSSEKLEDFKRLIQIPVDDLQIQRKAINELIKVMNDLSPKSNLRKRKRSQNLFRGRRASM

Molecular Weight

Approximately 21 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IFN-gamma Protein, Sheep (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-gamma Protein, Sheep (His)
Cat. No.:
HY-P72245
Quantity:
MCE Japan Authorized Agent: