IGSF11 Protein, Human (HEK293, Fc)

IGSF11 Protein functions as a cell adhesion molecule, facilitating cellular adhesion through homophilic interactions. It also stimulates cell growth, suggesting its role in regulating cellular proliferation. IGSF11 Protein, Human (HEK293, Fc) is the recombinant human-derived IGSF11 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of IGSF11 Protein, Human (HEK293, Fc) is 223 a.a., with molecular weight of 57-70 kDa.

IGSF11 Protein serves as a cell adhesion molecule by engaging in homophilic interactions, facilitating cellular adhesion processes. Additionally, it plays a role in stimulating cell growth, implying its involvement in the regulation of cellular proliferation.

Human

HEK293

C-hFc

Q5DX21 (L23-G245)

152404  [NCBI]

LEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIGLIAG

57-70 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.