IGSF11 Protein, Human (HEK293, Fc)
Based on 1 Customer Validation
IGSF11 Protein functions as a cell adhesion molecule, facilitating cellular adhesion through homophilic interactions. It also stimulates cell growth, suggesting its role in regulating cellular proliferation. IGSF11 Protein, Human (HEK293, Fc) is the recombinant human-derived IGSF11 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IGSF11 Protein functions as a cell adhesion molecule, facilitating cellular adhesion through homophilic interactions. It also stimulates cell growth, suggesting its role in regulating cellular proliferation. IGSF11 Protein, Human (HEK293, Fc) is the recombinant human-derived IGSF11 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
IGSF11 Protein serves as a cell adhesion molecule by engaging in homophilic interactions, facilitating cellular adhesion processes. Additionally, it plays a role in stimulating cell growth, implying its involvement in the regulation of cellular proliferation.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q5DX21-1 (L23-G245)
-
Molecular Construction
-
N-term
-
IGSF11 (L23-G245)
Accession # Q5DX21-1 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
IGSF11; CXADRL1; Immunoglobulin Superfamily Member 11; BTIGSF; VSIG3; Brain And Testis-Specific Immunoglobin Superfamily Protein; BT-IgSF; V-Set And Immunoglobulin Domain Containing 3; Igsf13; Immunoglobulin Superfamily, Member 11; CT119; Alternative Prot
-
AA Sequence
LEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIGLIAG
-
Predicted Molecular Mass
50.7 kDa
-
Molecular Weight
Approximately 55-70 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
