1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-11 Receptor
  5. IL-11R alpha
  6. IL-11R alpha Protein, Canine (HEK293, Fc)

IL-11R alpha (IL-11RA) is the IL-11 receptor subunit α and also acts as an agonist of IL-11. IL-11R alpha binds to IL6ST/gp130 on cell surfaces and induces signal transduction. IL-11R alpha activates Jak family of tyrosine kinases, JAK1, JAK2, and TYK2. IL-11R alpha induces proliferation and/or differentiation of skeletogenic progenitor or other mesenchymal cells. IL-11R alpha plays an important role in the progression and the differentiation of human gastric carcinomas. IL-11R alpha Protein, Canine (HEK293, Fc) is a recombinant protein with a Fc label produced by HEK293 cells.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
10 μg En stock
50 μg En stock
100 μg En stock
> 100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

  • Referencias

Descripciòn

IL-11R alpha (IL-11RA) is the IL-11 receptor subunit α and also acts as an agonist of IL-11. IL-11R alpha binds to IL6ST/gp130 on cell surfaces and induces signal transduction[1]. IL-11R alpha activates Jak family of tyrosine kinases, JAK1, JAK2, and TYK2[3]. IL-11R alpha induces proliferation and/or differentiation of skeletogenic progenitor or other mesenchymal cells[4]. IL-11R alpha plays an important role in the progression and the differentiation of human gastric carcinomas[5]. IL-11R alpha Protein, Canine (HEK293, Fc) is a recombinant protein with a Fc label produced by HEK293 cells.

Background

IL-11RA is highly expressed on stromal cells, including fibroblasts, smooth muscle cells, adipocytes, and hepatic/pancreatic stellate cells or pericytes, and also on epithelial/polarized cells, such as hepatocytes, alveolar epithelial cells, and kidney tubular epithelial cells[1].
The amino acid sequence of human IL-11R alpha protein has low homology between mouse and rat IL-11R alpha protein.
IL-11R alpha is the receptor of IL-11, and signaling mechanism triggered by IL-11 is mediated through IL-11R alpha. IL-11R alpha can bind IL-11 and then the comples attracts gp130 leading to signal transduction. Besides, IL11RA has been demonstrated to activate IL-11-mediated gp130 signaling but not the naturally occurring form of the soluble IL-11 receptor. Binding of IL-11 to IL11RA triggers heterodimerization, tyrosine phosphorylation, and activation of gp130. The activated IL11RA–gp130 receptor complex further activates Jak family of tyrosine kinases, JAK1, JAK2, and TYK2[3].
IL-11R alpha also acts as IL-11 agonist in vitro[3]. IL-11R alpha induces proliferation and/or differentiation of skeletogenic progenitor or other mesenchymal cells[4][5].

Species

Canine

Source

HEK293

Tag

C-hFc

Accession

A0A8I3S524/XP_538710 (V23-L363)

Gene ID
Molecular Construction
N-term
IL-11Rα (V23-L363)
Accession # A0A8I3S524/XP_538710
hFc
C-term
Protein Length

Partial

Synonyms
IL-11 R alpha; IL11R alpha; IL11RA; IL-11Ra; Il11ra2; NR1
AA Sequence

VSPCPQAWGPPGVQYGQPGRSMTLCCPGVTAGAPVSWFRDGETRLLQGPDSGLGHELVLAQADSTDEGTYICRTLDGALGGIVTLQLGYPPARPVVSCQAADYENFSCTWSPSQVSGLPTRYLTSYRKKTVPGADGQRMSPSTGPWPCPQDPPGAARCVVHGAEFWSQYRINVTEVNPLGTSTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASWTYPASWPRQPHFLLRFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDAGTWSAWSPEAWGTPSTGSLPKEIPAGGQPRKQLEEEPQADSPTPPRPSLLPDPRPLDQRDPL

Peso molecular

Approximately 67-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Pureza

≥ 85%, as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Envío

Shipping with dry ice.

Documentación
Referencias

IL-11R alpha Protein, Canine (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

IL-11R alpha Protein, Canine (HEK293, Fc)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
IL-11R alpha Protein, Canine (HEK293, Fc)
Cat. No.:
HY-P77398
Cantidad:
MCE Japan Authorized Agent: